DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7798 and LYZL4

DIOPT Version :9

Sequence 1:NP_611098.1 Gene:CG7798 / 36798 FlyBaseID:FBgn0034092 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001291315.1 Gene:LYZL4 / 131375 HGNCID:28387 Length:146 Species:Homo sapiens


Alignment Length:115 Identity:42/115 - (36%)
Similarity:64/115 - (55%) Gaps:8/115 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 VGRCSLARQLYRYGMAYNE---LPDWLCLVEGESSFNTKAINPSNVDGSVDWGLFQINDRYWCKP 81
            :|||::|::|:..|:.|.|   |.:|:||...||.||..||..:..:|...:||||:....||  
Human    22 LGRCTVAKKLHDGGLDYFEGYSLENWVCLAYFESKFNPMAIYENTREGYTGFGLFQMRGSDWC-- 84

  Fly    82 ADGRPSNDLCRLPCRLLLSDDIRYSIACAKYIRK-QQGFSAWVAWNNRCQ 130
              |....:.|.:.|..||:.::..:|.|||.|.| ::|..||..|:..||
Human    85 --GDHGRNRCHMSCSALLNPNLEKTIKCAKTIVKGKEGMGAWPTWSRYCQ 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7798NP_611098.1 LYZ1 18..139 CDD:238066 42/115 (37%)
LYZL4NP_001291315.1 LYZ_C 21..144 CDD:340383 42/115 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153911
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8437
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.860

Return to query results.
Submit another query.