DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7798 and LYZL2

DIOPT Version :9

Sequence 1:NP_611098.1 Gene:CG7798 / 36798 FlyBaseID:FBgn0034092 Length:148 Species:Drosophila melanogaster
Sequence 2:XP_011517608.1 Gene:LYZL2 / 119180 HGNCID:29613 Length:181 Species:Homo sapiens


Alignment Length:95 Identity:34/95 - (35%)
Similarity:50/95 - (52%) Gaps:10/95 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLTL--SLATGRQ---VGRCSLARQLYRYGMAYN---ELPDWLCLVEGESSFNTKAINPSNVDGS 65
            :|||  .|.||.:   ..||.||:...|.|:...   .|.:|:|:...||.:||.|....: |||
Human    52 ILTLIGCLVTGAESKIYTRCKLAKIFSRAGLDNYWGFSLGNWICMAYYESGYNTTAQTVLD-DGS 115

  Fly    66 VDWGLFQINDRYWCKPADGRPSNDLCRLPC 95
            :|:|:||||...||:....:.:|. |.:.|
Human   116 IDYGIFQINSFAWCRRGKLKENNH-CHVAC 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7798NP_611098.1 LYZ1 18..139 CDD:238066 28/84 (33%)
LYZL2XP_011517608.1 lysozyme_like 66..>145 CDD:294153 28/81 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153957
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8437
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.960

Return to query results.
Submit another query.