DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7798 and spaca5l

DIOPT Version :10

Sequence 1:NP_611098.1 Gene:CG7798 / 36798 FlyBaseID:FBgn0034092 Length:148 Species:Drosophila melanogaster
Sequence 2:XP_031748221.1 Gene:spaca5l / 116407060 XenbaseID:XB-GENE-29092563 Length:146 Species:Xenopus tropicalis


Alignment Length:146 Identity:52/146 - (35%)
Similarity:73/146 - (50%) Gaps:23/146 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VLLTLSLATGRQV-GRCSLARQL--------YRYGMAYNELPDWLCLVEGESSFNTKAINPSNVD 63
            :|......|..:| .:|.||:.|        |.|.:|     :|:||...||.:.|.|:..:.  
 Frog     8 ILFAFLAGTDAKVFAKCDLAKVLKAGGLDGYYGYSLA-----NWMCLSYYESRYTTNAMYDNG-- 65

  Fly    64 GSVDWGLFQINDRYWCKPADGRPSNDL--CRLPCRLLLSDDIRYSIACAK-YIRKQQGFSAWVAW 125
            .|.|:|:||||..:||.  ||:.|..:  |.:.|..|::|||...|.||| .:|...|..|||||
 Frog    66 WSRDYGVFQINSYWWCN--DGKTSGAVAACGISCSNLMNDDITDDITCAKRVVRDPNGMGAWVAW 128

  Fly   126 NNRCQG--VKPNVNHC 139
            ||.|:.  |...|:.|
 Frog   129 NNYCKNKDVSSFVSGC 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7798NP_611098.1 LYZ_C_invert 18..139 CDD:381618 49/134 (37%)
spaca5lXP_031748221.1 LYZ_C 19..144 CDD:340383 49/133 (37%)

Return to query results.
Submit another query.