DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7798 and LOC100493330

DIOPT Version :9

Sequence 1:NP_611098.1 Gene:CG7798 / 36798 FlyBaseID:FBgn0034092 Length:148 Species:Drosophila melanogaster
Sequence 2:XP_002935753.1 Gene:LOC100493330 / 100493330 -ID:- Length:140 Species:Xenopus tropicalis


Alignment Length:134 Identity:42/134 - (31%)
Similarity:72/134 - (53%) Gaps:12/134 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IWLLVLLTLSLA-TGRQVGRCSLARQLYRYGMA----YNELPDWLCLVEGESSFNTKAINPSNVD 63
            |.|::::..:|| ....:.|||:.|.:.|.|:|    |: |.|::||....|.::| :::.|   
 Frog     3 ICLMIVVAAALAGNSWALDRCSVVRAIRRGGLAGIKGYS-LGDFVCLAYHASRYDT-SLHRS--- 62

  Fly    64 GSVDWGLFQINDRYWCKPADGRPSNDLCRLPCRLLLSDDIRYSIACAK-YIRKQQGFSAWVAWNN 127
             ..::|:||||..:||.........::||:|||.||:.:|...:.|.| .:....|.:||..|..
 Frog    63 -PTEYGIFQINSYWWCDDGKTPGRKNVCRIPCRNLLNTNIADDVKCVKRIVSDPNGLAAWEPWKK 126

  Fly   128 RCQG 131
            .|:|
 Frog   127 YCRG 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7798NP_611098.1 LYZ1 18..139 CDD:238066 38/119 (32%)
LOC100493330XP_002935753.1 LYZ_C 20..140 CDD:340383 38/117 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 101 1.000 Inparanoid score I4849
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9324
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.070

Return to query results.
Submit another query.