DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mrj and JJJ3

DIOPT Version :9

Sequence 1:NP_001246364.1 Gene:mrj / 36797 FlyBaseID:FBgn0034091 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_012631.3 Gene:JJJ3 / 853560 SGDID:S000003858 Length:172 Species:Saccharomyces cerevisiae


Alignment Length:107 Identity:33/107 - (30%)
Similarity:51/107 - (47%) Gaps:14/107 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YYKILDVSRSATDSEVKKAYRKLALKWHPDKNPDNLDE--ANKRFRELSEAYEVLSDARKRRIYD 66
            :|:||.:...||..|:|||||...|..||||...::.:  :|....::.:||::||:.:.||.||
Yeast     9 HYEILRIPSDATQDEIKKAYRNRLLNTHPDKLSKSIHDTVSNVTINKIQDAYKILSNIKTRREYD 73

  Fly    67 ARATLHKSSNSGSSSSNSSSYTRYRNGGTGGSSSYGRDYDYD 108
             |..|......|           :.|.|.|.......|:.:|
Yeast    74 -RLILENYKRQG-----------FHNCGDGLDEFSLDDFSFD 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mrjNP_001246364.1 DnaJ 2..>66 CDD:223560 23/63 (37%)
DnaJ 3..66 CDD:278647 23/63 (37%)
JJJ3NP_012631.3 DnaJ 8..73 CDD:395170 23/63 (37%)
zf-CSL 93..164 CDD:398744 2/11 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.