DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mrj and AT4G39150

DIOPT Version :10

Sequence 1:NP_725545.2 Gene:mrj / 36797 FlyBaseID:FBgn0034091 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_195626.1 Gene:AT4G39150 / 830070 AraportID:AT4G39150 Length:345 Species:Arabidopsis thaliana


Alignment Length:64 Identity:32/64 - (50%)
Similarity:41/64 - (64%) Gaps:1/64 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DYYKILDVSRSATDSEVKKAYRKLALKWHPDKNPDNLDEANKRFRELSEAYEVLSDARKRRIYD 66
            :||.||.|...|:.:|:||||...|.:.||||||.: .:|.|.|:.|.|||:||.|..||..||
plant     6 EYYDILGVKIDASGAEIKKAYYVQARQVHPDKNPGD-PQAAKNFQILGEAYQVLGDPEKRTAYD 68

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mrjNP_725545.2 DnaJ 3..66 CDD:395170 30/62 (48%)
AT4G39150NP_195626.1 DnaJ 6..68 CDD:395170 30/62 (48%)
DnaJ-X 135..322 CDD:433858
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.