DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mrj and Dnajb1

DIOPT Version :9

Sequence 1:NP_001246364.1 Gene:mrj / 36797 FlyBaseID:FBgn0034091 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_061278.1 Gene:Dnajb1 / 81489 MGIID:1931874 Length:340 Species:Mus musculus


Alignment Length:361 Identity:88/361 - (24%)
Similarity:126/361 - (34%) Gaps:146/361 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DYYKILDVSRSATDSEVKKAYRKLALKWHPDKNPDNLDEANKRFRELSEAYEVLSDARKRRIYDA 67
            |||:.|.::|.|:|.|:|:|||:.||::|||||.:  ..|.::|:|::|||:||||.|||.|:| 
Mouse     4 DYYQTLGLARGASDDEIKRAYRRQALRYHPDKNKE--PGAEEKFKEIAEAYDVLSDPRKREIFD- 65

  Fly    68 RATLHKSSNSGSSSSNSSSYTRYRNGGTGGSSSYGRDYDYDYYPGSGYGSGSGRRSGNRYQAFTF 132
                                 ||...|..|              ||..|..||..:|..: ::||
Mouse    66 ---------------------RYGEEGLKG--------------GSPSGGSSGGANGTSF-SYTF 94

  Fly   133 RNIFEGTPFHKMFEKKRRIYDEYGKDGLGDRGQSRSHARHHYSTHDFDDFDILGGFQFAFRPPEE 197
            .                           ||                                |..
Mouse    95 H---------------------------GD--------------------------------PHA 100

  Fly   198 VFREFFGIHSPFADLFRDANGHS--------NGSTSGSSG-SRRNGGSSGSSRHHHHHHQHKVAS 253
            :|.||||..:||...|...||..        :....|..| :..|.|.|..|:    ....|...
Mouse   101 MFAEFFGGRNPFDTFFGQRNGEEGMDIDDTFSSFPMGMGGFTNMNFGRSRPSQ----EPTRKKQD 161

  Fly   254 PFGAPMLNYSMMDFFMPTSGFTSFSSMTHGNGSSGVTHISSGPGASVKRTSTSTVFVNGKKLMT- 317
            |.....|..|:.:.:   ||.|....::|..        .:..|.|::         |..|::| 
Mouse   162 PPVTHDLRVSLEEIY---SGCTKKMKISHKR--------LNPDGKSIR---------NEDKILTI 206

  Fly   318 --KRVVENGKETVFSYEND------------VLKSK 339
              ||..:.|.:..|..|.|            |||.|
Mouse   207 EVKRGWKEGTKITFPKEGDQTSNNIPADIVFVLKDK 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mrjNP_001246364.1 DnaJ 2..>66 CDD:223560 33/62 (53%)
DnaJ 3..66 CDD:278647 33/62 (53%)
Dnajb1NP_061278.1 DnaJ 1..340 CDD:223560 88/361 (24%)
DnaJ 4..65 CDD:278647 33/62 (53%)
DnaJ_C 162..326 CDD:199909 22/101 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.