DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mrj and dnajb14

DIOPT Version :9

Sequence 1:NP_001246364.1 Gene:mrj / 36797 FlyBaseID:FBgn0034091 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001071255.1 Gene:dnajb14 / 792752 ZFINID:ZDB-GENE-061110-138 Length:380 Species:Danio rerio


Alignment Length:325 Identity:70/325 - (21%)
Similarity:101/325 - (31%) Gaps:145/325 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DYYKILDVSRSATDSEVKKAYRKLALKWHPDKNPDNLDEANKRFRELSEAYEVLSDARKRRIYDA 67
            :||::|.:.:.|:|.|:|||||:||||:|||||  :...|...|:::..||.|||:..|:|.||.
Zfish   111 NYYEVLGIRKDASDDELKKAYRQLALKFHPDKN--HAPGATDAFKKIGNAYSVLSNPEKKRQYDL 173

  Fly    68 RATLHKSSNSGSSSSNSSSYTRYRNGGTGGSSSYGRDYDYDYYPGSGYGSGSGRRSGNRYQAFTF 132
                     ||....::.:|:.:                                          
Zfish   174 ---------SGGEEPSTPNYSSH------------------------------------------ 187

  Fly   133 RNIFEGTPFHKMFEKKRRIYDEYGKDGLGDRGQSRSHARHHYSTHDFDDFDILGGFQFAFRPPEE 197
                ||..||:.||.                                   ||         .||:
Zfish   188 ----EGFDFHRGFES-----------------------------------DI---------TPED 204

  Fly   198 VFREFFGIHSPFADLFRDANG----HSNGSTSGSSGSRRNGGSSGSSRHHHHHHQHKVASPFGAP 258
            :|..|||...|.::.....||    |....|.|.....|..|                       
Zfish   205 LFNMFFGGSFPSSNSHEFTNGRTYSHHTEETRGERVEERGDG----------------------- 246

  Fly   259 MLNYSMMDFFMPTSGFTSFSSMTHGNGSSGVTHISSGPGASVKRTSTSTVFVNGKKLMTKRVVEN 323
              .:||....||.......|.::.       ..:|:.|.:...|.||...        .||..||
Zfish   247 --GFSMFIQLMPIVVLVLVSILSQ-------LLVSTPPYSLYSRPSTGQT--------VKRQTEN 294

  Fly   324  323
            Zfish   295  294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mrjNP_001246364.1 DnaJ 2..>66 CDD:223560 29/62 (47%)
DnaJ 3..66 CDD:278647 29/62 (47%)
dnajb14NP_001071255.1 DnaJ 110..>218 CDD:223560 49/207 (24%)
DnaJ 111..172 CDD:278647 29/62 (47%)
DUF1977 272..372 CDD:286411 9/31 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.