Sequence 1: | NP_001246364.1 | Gene: | mrj / 36797 | FlyBaseID: | FBgn0034091 | Length: | 346 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_789805.1 | Gene: | Dnajc22 / 72778 | MGIID: | 1920028 | Length: | 339 | Species: | Mus musculus |
Alignment Length: | 59 | Identity: | 25/59 - (42%) |
---|---|---|---|
Similarity: | 36/59 - (61%) | Gaps: | 0/59 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 YKILDVSRSATDSEVKKAYRKLALKWHPDKNPDNLDEANKRFRELSEAYEVLSDARKRR 63 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
mrj | NP_001246364.1 | DnaJ | 2..>66 | CDD:223560 | 25/59 (42%) |
DnaJ | 3..66 | CDD:278647 | 25/59 (42%) | ||
Dnajc22 | NP_789805.1 | DnaJ | 278..335 | CDD:197617 | 23/55 (42%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0714 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |