DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mrj and Dnajb2

DIOPT Version :9

Sequence 1:NP_001246364.1 Gene:mrj / 36797 FlyBaseID:FBgn0034091 Length:346 Species:Drosophila melanogaster
Sequence 2:XP_006245338.1 Gene:Dnajb2 / 689593 RGDID:1591035 Length:324 Species:Rattus norvegicus


Alignment Length:344 Identity:107/344 - (31%)
Similarity:138/344 - (40%) Gaps:138/344 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVDYYKILDVSRSATDSEVKKAYRKLALKWHPDKNPDNLDEANKRFRELSEAYEVLSDARKRRIY 65
            |..||:||||.|||:..::||||||.||:|||||||||.:.|.|:|:|::||||||||       
  Rat     1 MASYYEILDVPRSASPDDIKKAYRKKALQWHPDKNPDNKEFAEKKFKEVAEAYEVLSD------- 58

  Fly    66 DARATLHKSSNSGSSSSNSSSYTRYRNGGTGGSSSYGRDYDYDYYPGSGYGSGSGRRSGNRYQAF 130
                                                                             
  Rat    59 ----------------------------------------------------------------- 58

  Fly   131 TFRNIFEGTPFHKMFEKKRRIYDEYGKDGLGDRGQSRSHARHHYSTHDFDDFDILGGFQFAFRPP 195
                           :.||.|||.||::||...|...|.:    .|...:.     ||.|.||.|
  Rat    59 ---------------KHKREIYDRYGREGLTGAGSGPSRS----ETGGMEP-----GFTFTFRSP 99

  Fly   196 EEVFREFFGIHSPFADLFRDANGHSNGSTSGSSGSRRNGGSSGSSRHHHHHHQHKVASPFGAPML 260
            |||||||||...||::||.|....|.....||                      ::..||     
  Rat   100 EEVFREFFGSGDPFSELFDDLGAFSELQNQGS----------------------RLTGPF----- 137

  Fly   261 NYSMMDFFMPTSGFTSFSSMTHGNGSSGVTHISSGPGASVKRT-STSTVFVNGKKLMTKRVVENG 324
                         || |||...||.....:..|..|||...|: ||||.||.|:::.|:|::|||
  Rat   138 -------------FT-FSSSFPGNSDFSSSSFSFSPGAGAFRSVSTSTTFVQGRRITTRRIMENG 188

  Fly   325 KETVFSYENDVLKSKTVMG 343
            :|.|...|:..|||.::.|
  Rat   189 QERVEVEEDGQLKSVSING 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mrjNP_001246364.1 DnaJ 2..>66 CDD:223560 38/63 (60%)
DnaJ 3..66 CDD:278647 38/62 (61%)
Dnajb2XP_006245338.1 DnaJ 3..>110 CDD:223560 65/202 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 98 1.000 Domainoid score I6988
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4902
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1472647at2759
OrthoFinder 1 1.000 - - FOG0000721
OrthoInspector 1 1.000 - - otm46170
orthoMCL 1 0.900 - - OOG6_102921
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X251
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.720

Return to query results.
Submit another query.