DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mrj and Dnajb7

DIOPT Version :9

Sequence 1:NP_001246364.1 Gene:mrj / 36797 FlyBaseID:FBgn0034091 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001123982.1 Gene:Dnajb7 / 685839 RGDID:1589047 Length:303 Species:Rattus norvegicus


Alignment Length:331 Identity:93/331 - (28%)
Similarity:132/331 - (39%) Gaps:129/331 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVDYYKILDVSRSATDSEVKKAYRKLALKWHPDKNPDNLDEANKRFRELSEAYEVLSDARKRRIY 65
            |||||::|.|.|.|:..::|:||||:||||||||||:|.:||.::|:|::|||||||        
  Rat     1 MVDYYEVLGVQRYASPEDIKRAYRKVALKWHPDKNPENKEEAERKFKEVAEAYEVLS-------- 57

  Fly    66 DARATLHKSSNSGSSSSNSSSYTRYRNGGTGGSSSYGRDYDYDYYPGSGYGSGSGRRSGNRYQAF 130
                                      ||                                     
  Rat    58 --------------------------NG------------------------------------- 59

  Fly   131 TFRNIFEGTPFHKMFEKKRRIYDEYGKDGLGDRGQSRSHARHHYSTHDFDDFDILGGFQFAFRPP 195
                            :||.|||:|||:||...|.|.......|.              |.||..
  Rat    60 ----------------EKRDIYDKYGKEGLTGGGGSHLDDEREYG--------------FTFRKA 94

  Fly   196 EEVFREFFGIHSPFA-DLFRDANGHSNGSTSGSSGSRRNGGSSGSSRHHHHHHQHKVASPFGAPM 259
            ::||:|.||...||: ..|.|:......|:..|||||..|  |..||.:.:        |..|.:
  Rat    95 DDVFKEIFGERDPFSFHFFEDSLADLLSSSRSSSGSRSRG--SLFSRSYDY--------PVFARL 149

  Fly   260 LNYSMMDFFMPTSGFTSFSSMTHGNGSSGVTHISS----GPGASVKRTSTSTVFVNGKKLMTKRV 320
            .:|.        :|::.:.|    .|...:|.:||    .||.......|.:| :||:.:.||:.
  Rat   150 SSYD--------TGYSPYVS----RGHESLTSVSSLAFEDPGVGNYIPITPSV-INGRNVKTKKT 201

  Fly   321 VENGKE 326
            .||.:|
  Rat   202 FENRQE 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mrjNP_001246364.1 DnaJ 2..>66 CDD:223560 35/63 (56%)
DnaJ 3..66 CDD:278647 34/62 (55%)
Dnajb7NP_001123982.1 DnaJ 3..66 CDD:278647 39/149 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347686
Domainoid 1 1.000 98 1.000 Domainoid score I6988
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000721
OrthoInspector 1 1.000 - - otm46170
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43948
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X251
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.800

Return to query results.
Submit another query.