DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mrj and Dnajb4

DIOPT Version :9

Sequence 1:NP_001246364.1 Gene:mrj / 36797 FlyBaseID:FBgn0034091 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001343292.1 Gene:Dnajb4 / 67035 MGIID:1914285 Length:337 Species:Mus musculus


Alignment Length:154 Identity:57/154 - (37%)
Similarity:75/154 - (48%) Gaps:44/154 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DYYKILDVSRSATDSEVKKAYRKLALKWHPDKNPDNLDEANKRFRELSEAYEVLSDARKRRIYDA 67
            |||.||.:.:.|||.:|||||||.|||:|||||..  .:|.::|:|::||||||||.:||.||| 
Mouse     4 DYYHILGIDKGATDEDVKKAYRKQALKFHPDKNKS--PQAEEKFKEVAEAYEVLSDPKKREIYD- 65

  Fly    68 RATLHKSSNSGSSSSNSSSYTRYRNGGTGGSSSYGRDYDYD-----------YYPGS-------G 114
                 :....|            ..||.||:...|..:.|.           ::.||       |
Mouse    66 -----QFGEEG------------LKGGAGGTDGQGGTFRYTFHGDPHATFAAFFGGSNPFEIFFG 113

  Fly   115 YGSGSGRRS------GNRYQAFTF 132
            ...|.||.|      |:.:.||.|
Mouse   114 RRMGGGRDSEEMEIDGDPFSAFGF 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mrjNP_001246364.1 DnaJ 2..>66 CDD:223560 37/62 (60%)
DnaJ 3..66 CDD:278647 37/62 (60%)
Dnajb4NP_001343292.1 DnaJ 1..332 CDD:223560 57/154 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.