DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mrj and Dnaja1

DIOPT Version :9

Sequence 1:NP_001246364.1 Gene:mrj / 36797 FlyBaseID:FBgn0034091 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_075223.1 Gene:Dnaja1 / 65028 RGDID:620942 Length:397 Species:Rattus norvegicus


Alignment Length:163 Identity:57/163 - (34%)
Similarity:84/163 - (51%) Gaps:31/163 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YYKILDVSRSATDSEVKKAYRKLALKWHPDKNPDNLDEANKRFRELSEAYEVLSDARKRRIYDAR 68
            ||.:|.|..:||..|:||||||||||:||||||:.    .::|:::|:|||||:|::||.:||  
  Rat     7 YYDVLGVKPNATQEELKKAYRKLALKYHPDKNPNE----GEKFKQISQAYEVLADSKKRELYD-- 65

  Fly    69 ATLHKSSNSGSSSSNSSSYTRYRNGGTGGSSSYGRDYD-YDYYPGSGYGSGSGRRSGN--RYQAF 130
                    .|...:       .:.||.||  .:|...| :|.:.|.|......||..|  ...:.
  Rat    66 --------KGGEQA-------IKEGGAGG--GFGSPMDIFDMFFGGGGRMQRERRGKNVVHQLSV 113

  Fly   131 TFRNIFEGTPFHKMFEKKRRIYDEY----GKDG 159
            |..:::.|.. .|:..:|..|.|:.    ||.|
  Rat   114 TLEDLYNGAT-RKLALQKNVICDKCEGRGGKKG 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mrjNP_001246364.1 DnaJ 2..>66 CDD:223560 33/61 (54%)
DnaJ 3..66 CDD:278647 33/61 (54%)
Dnaja1NP_075223.1 PTZ00037 2..394 CDD:240236 57/163 (35%)
CXXCXGXG motif 134..141 1/6 (17%)
CXXCXGXG motif 150..157
CXXCXGXG motif 177..184
CXXCXGXG motif 193..200
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 352..397
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.