DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mrj and zgc:122979

DIOPT Version :9

Sequence 1:NP_001246364.1 Gene:mrj / 36797 FlyBaseID:FBgn0034091 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001032663.2 Gene:zgc:122979 / 641576 ZFINID:ZDB-GENE-051127-45 Length:360 Species:Danio rerio


Alignment Length:117 Identity:41/117 - (35%)
Similarity:70/117 - (59%) Gaps:18/117 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VDYYKILDVSRSATDSEVKKAYRKLALKWHPDKNPDNLDEANKRFRELSEAYEVLSDARKRRIYD 66
            ||||.:|.||..:.:.|::|||::|||::|||||.|  .:|..:|:::::||:||:|..||.|||
Zfish    50 VDYYSVLGVSNDSNEEEIRKAYKRLALRYHPDKNSD--ADAEDKFKQIAQAYDVLTDPEKRNIYD 112

  Fly    67 ARA--------TLHKSSNSGSSSSNSSSYTRYRNGGTGGSSSYGRDYDYDYY 110
            .:.        |.:|:..|.:|.:::.|:..:.|        :..|.|.|.:
Zfish   113 QQGLTKGGVAPTCNKTDPSHNSKADAHSWHMFFN--------FDLDSDDDLF 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mrjNP_001246364.1 DnaJ 2..>66 CDD:223560 30/63 (48%)
DnaJ 3..66 CDD:278647 29/62 (47%)
zgc:122979NP_001032663.2 DnaJ 50..355 CDD:223560 41/117 (35%)
DnaJ 51..112 CDD:278647 29/62 (47%)
DnaJ_C 185..345 CDD:199909
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.