DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mrj and Dnaja4

DIOPT Version :9

Sequence 1:NP_001246364.1 Gene:mrj / 36797 FlyBaseID:FBgn0034091 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001344804.1 Gene:Dnaja4 / 58233 MGIID:1927638 Length:426 Species:Mus musculus


Alignment Length:163 Identity:59/163 - (36%)
Similarity:85/163 - (52%) Gaps:28/163 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YYKILDVSRSATDSEVKKAYRKLALKWHPDKNPDNLDEANKRFRELSEAYEVLSDARKRRIYDAR 68
            ||.||.|..||:..|:||||||||||:|||||||.    .::|:.:|:|||||||.:||.|||  
Mouse    36 YYDILGVKPSASPEEIKKAYRKLALKYHPDKNPDE----GEKFKLISQAYEVLSDPKKRDIYD-- 94

  Fly    69 ATLHKSSNSGSSSSNSSSYTRYRNGGTGGSSSYGRDYD-YDYYPGSGYGSGSGRRSGN--RYQAF 130
                    .|...:       .:.||: ||.|:....| :|.:.|.|......||..|  ...:.
Mouse    95 --------QGGEQA-------IKEGGS-GSPSFSSPMDIFDMFFGGGGRMTRERRGKNVVHQLSV 143

  Fly   131 TFRNIFEGTPFHKMFEKKRRIYDEYGKDGLGDR 163
            |..:::.|.. .|:..:|..|.::.  :|:|.:
Mouse   144 TLEDLYNGIT-KKLALQKNVICEKC--EGIGGK 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mrjNP_001246364.1 DnaJ 2..>66 CDD:223560 37/61 (61%)
DnaJ 3..66 CDD:278647 37/61 (61%)
Dnaja4NP_001344804.1 DnaJ 15..423 CDD:333066 59/163 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.