DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mrj and Samd13

DIOPT Version :9

Sequence 1:NP_001246364.1 Gene:mrj / 36797 FlyBaseID:FBgn0034091 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_064474.1 Gene:Samd13 / 56764 RGDID:708544 Length:223 Species:Rattus norvegicus


Alignment Length:346 Identity:83/346 - (23%)
Similarity:132/346 - (38%) Gaps:150/346 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVDYYKILDVSRSATDSEVKKAYRKLALKWHPDKNPDNLDEANKRFRELSEAYEVLSDARKRRIY 65
            ||:|||:|.|.:.|:.|::|||:.:|||:.||||||.:.:.|.::|::::|||::||||:||:.|
  Rat     1 MVNYYKVLGVPQDASSSDIKKAFHQLALQVHPDKNPGDREAAEEKFKQVAEAYQILSDAKKRKDY 65

  Fly    66 DARATLHKSSNSGSSSSNSSSYTRYRNGGTGGSSSYGRDYDYDYYPGSGYGSGSGRRSGNRYQAF 130
            |                 .|.::|.:.....|.   |||       .:.:......|...|    
  Rat    66 D-----------------RSRWSRTKEELIRGD---GRD-------ETNWEEEICSRRPRR---- 99

  Fly   131 TFRNIFEGTPFHKMFEKKRRIYDEYGKDGLGDRGQSRSHARHHYSTHDFDDFDILGGFQFAFRPP 195
            ||:.:.|                                           |.|:..| .:.|..|
  Rat   100 TFQTVIE-------------------------------------------DEDLFSG-DYLFTGP 120

  Fly   196 EEVFREFFGIHSPFADLFRDANGHSNGSTSGSSGSRRNGGSSGSSRHHHHHHQHKVASPFGAPML 260
                                           .:.|||     |||                    
  Rat   121 -------------------------------MTHSRR-----GSS-------------------- 129

  Fly   261 NYSMMDFFMPT----SGFTSF----SSMTHGNGSSGVTHISSGPGASVKRTSTSTVFVNGKKLMT 317
                 :||..|    :||::|    |..:..:..:.|.:||.|.| ..:..:|.:..:|||:::|
  Rat   130 -----NFFTVTPIIDTGFSTFVSQESKSSPDDSEAFVPYISHGMG-KFRLVTTCSQIMNGKRVVT 188

  Fly   318 KRVVEN--GKETVFSYENDVL 336
            ||||||  |.:.:   ||:.|
  Rat   189 KRVVENIQGPKKI---ENERL 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mrjNP_001246364.1 DnaJ 2..>66 CDD:223560 31/63 (49%)
DnaJ 3..66 CDD:278647 30/62 (48%)
Samd13NP_064474.1 DnaJ 2..>67 CDD:223560 33/81 (41%)
DnaJ 3..66 CDD:278647 30/62 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 116 1.000 Inparanoid score I4721
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D593036at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR43948
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X251
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.930

Return to query results.
Submit another query.