DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mrj and Dnajb12

DIOPT Version :9

Sequence 1:NP_001246364.1 Gene:mrj / 36797 FlyBaseID:FBgn0034091 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001361685.1 Gene:Dnajb12 / 56709 MGIID:1931881 Length:378 Species:Mus musculus


Alignment Length:167 Identity:57/167 - (34%)
Similarity:81/167 - (48%) Gaps:39/167 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DYYKILDVSRSATDSEVKKAYRKLALKWHPDKNPDNLDEANKRFRELSEAYEVLSDARKRRIYDA 67
            |||:||.|||||:|.::||||||||||:|||||  :...|.:.|:.:..||.|||:..||:.|| 
Mouse   111 DYYEILGVSRSASDEDLKKAYRKLALKFHPDKN--HAPGATEAFKAIGTAYAVLSNPEKRKQYD- 172

  Fly    68 RATLHKSSNSGSSSSNSSSYTRYRNGGTGGSSSYGRDYDYDYYP--------GSGYGSGSGRRSG 124
                    ..|...|.::     |:|.:.|  .:.|.::.|..|        |.|:.|.:.....
Mouse   173 --------QFGDDKSQAA-----RHGHSHG--DFHRGFEADISPEDLFNMFFGGGFPSSNVHVYS 222

  Fly   125 NRYQAFTFRNIFEGTPFHKMFEKKRRIYDEYGKDGLG 161
            |....:|::.           .:.||  |..|..|||
Mouse   223 NGRMRYTYQQ-----------RQDRR--DNQGDGGLG 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mrjNP_001246364.1 DnaJ 2..>66 CDD:223560 35/62 (56%)
DnaJ 3..66 CDD:278647 35/62 (56%)
Dnajb12NP_001361685.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 45..97
DnaJ_bact 111..>237 CDD:274090 50/154 (32%)
DUF1977 269..369 CDD:370429
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.