DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mrj and dnajb2

DIOPT Version :9

Sequence 1:NP_001246364.1 Gene:mrj / 36797 FlyBaseID:FBgn0034091 Length:346 Species:Drosophila melanogaster
Sequence 2:XP_012825839.2 Gene:dnajb2 / 548454 XenbaseID:XB-GENE-951530 Length:361 Species:Xenopus tropicalis


Alignment Length:348 Identity:101/348 - (29%)
Similarity:131/348 - (37%) Gaps:149/348 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVDYYKILDVSRSATDSEVKKAYRKLALKWHPDKNPDNLDEANKRFRELSEAYEVLSDARKRRIY 65
            |||||.||.|.|:|:..::|:|||||||:|||||||||.:.|.::|::::||||||||..||..|
 Frog     1 MVDYYDILGVPRNASQDDIKRAYRKLALRWHPDKNPDNKEHAERKFKDIAEAYEVLSDGEKREAY 65

  Fly    66 DARATLHKSSNSGSSSSNSSSYTRYRNGGTGGSSSYGRDYDYDYYPGSGYGSGSGRRSGNRYQAF 130
            |       :..||.|.                             ||:                 
 Frog    66 D-------NMTSGFSD-----------------------------PGA----------------- 77

  Fly   131 TFRNIFEGTPFHKMFEKKRRIYDEYGKDGLGDRGQSRSHARHHYSTHDFDDFDILGGFQFAFRPP 195
                 |..|...:.|:                                         |.|.||.|
 Frog    78 -----FRATRVQRPFD-----------------------------------------FGFQFRSP 96

  Fly   196 EEVFREFFGIHSPFA-----DLFRDANGHSNGSTSGSSGSRRNGGSSGSSRHHHHHHQHKVASPF 255
            |:|||:|||...||.     |:|...| |.:|.|                     ||.:.|    
 Frog    97 EDVFRDFFGGKDPFPHMIGDDVFMFPN-HPHGVT---------------------HHANSV---- 135

  Fly   256 GAPMLNYSMMDFFMPTSGFTSFSSMTHGNGSSGVTHISSGPGASVKRTSTSTVFVNGKKLMTKRV 320
              ||         .|:|.........|..|..|..:..|        .||||.|||||::.|||:
 Frog   136 --PM---------FPSSFHFGNEFSFHSGGLGGSRNFCS--------VSTSTKFVNGKRITTKRI 181

  Fly   321 VENGKETVFSYENDVLKSKTVMG 343
            :||..|.:...|:..|||..|.|
 Frog   182 MENDVERIEVEEDGELKSILVNG 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mrjNP_001246364.1 DnaJ 2..>66 CDD:223560 38/63 (60%)
DnaJ 3..66 CDD:278647 37/62 (60%)
dnajb2XP_012825839.2 PRK10767 3..>106 CDD:236757 58/201 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I6754
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4902
Inparanoid 1 1.050 125 1.000 Inparanoid score I4555
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1472647at2759
OrthoFinder 1 1.000 - - FOG0000721
OrthoInspector 1 1.000 - - otm49253
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X251
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.970

Return to query results.
Submit another query.