DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mrj and DNAJB11

DIOPT Version :9

Sequence 1:NP_001246364.1 Gene:mrj / 36797 FlyBaseID:FBgn0034091 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_057390.1 Gene:DNAJB11 / 51726 HGNCID:14889 Length:358 Species:Homo sapiens


Alignment Length:99 Identity:44/99 - (44%)
Similarity:63/99 - (63%) Gaps:9/99 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DYYKILDVSRSATDSEVKKAYRKLALKWHPDKNPDNLDEANKRFRELSEAYEVLSDARKRRIYDA 67
            |:||||.|.|||:..::|||||||||:.|||:|||: .:|.::|::|..|||||||:.||:.||.
Human    25 DFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDD-PQAQEKFQDLGAAYEVLSDSEKRKQYDT 88

  Fly    68 RATLHKSSNSGSSSSNSSSYTRYRN------GGT 95
            ..  .:....|..||:...::.:..      |||
Human    89 YG--EEGLKDGHQSSHGDIFSHFFGDFGFMFGGT 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mrjNP_001246364.1 DnaJ 2..>66 CDD:223560 36/62 (58%)
DnaJ 3..66 CDD:278647 36/62 (58%)
DNAJB11NP_057390.1 DnaJ 22..344 CDD:223560 44/99 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.