DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mrj and Dnajb8

DIOPT Version :9

Sequence 1:NP_001246364.1 Gene:mrj / 36797 FlyBaseID:FBgn0034091 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001102718.1 Gene:Dnajb8 / 500253 RGDID:1561981 Length:230 Species:Rattus norvegicus


Alignment Length:348 Identity:108/348 - (31%)
Similarity:145/348 - (41%) Gaps:133/348 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVDYYKILDVSRSATDSEVKKAYRKLALKWHPDKNPDNLDEANKRFRELSEAYEVLSDARKRRIY 65
            |.:||::|.|..||:..::|||||||||:|||||||||.:||.|:|:::|||||||||::||.:|
  Rat     1 MANYYEVLGVQSSASPEDIKKAYRKLALRWHPDKNPDNKEEAEKKFKQVSEAYEVLSDSKKRSVY 65

  Fly    66 DARATLHKSSNSGSSSSNSSSYTRYRNGGTGGSSSYGRDYDYDYYPGSGYGSGSGRRSGNRYQAF 130
            |         .:|...        :|.|  ||:|          .|.:|                
  Rat    66 D---------RAGCDG--------WRAG--GGAS----------VPHAG---------------- 85

  Fly   131 TFRNIFEGTPFHKMFEKKRRIYDEYGKDGLGDRGQSRSHARHHYSTHDFDDFDILGGFQFAFRPP 195
                     ||                                             |..:.||.|
  Rat    86 ---------PF---------------------------------------------GAGYPFRNP 96

  Fly   196 EEVFREFFGIHSPFADLFRDANGHSNGSTSGSSGSRRNGGSSGSSRHHHHHHQHKVASPFGAPML 260
            |::||||||...||:..|.|......|...|..|:..:|                    ||    
  Rat    97 EDIFREFFGGLDPFSFEFWDTPFSDRGRPHGLRGAFSSG--------------------FG---- 137

  Fly   261 NYSMMDFFMPTSGFTSFSSMTHGNGS----SGVTHISSGPGAS-VKRTSTSTVFVNGKKLMTKRV 320
                 :|......|:||.::.||.||    |..:...||.|:| .|...:||..|||:|:.|||:
  Rat   138 -----EFPAFMEAFSSFDTLGHGGGSHSTFSSTSFGGSGSGSSGFKSVMSSTEMVNGRKVTTKRI 197

  Fly   321 VENGKETVFSYENDVLKSKTVMG 343
            ||||.|.|...|:..|:|.||.|
  Rat   198 VENGHERVEVEEDGKLRSVTVNG 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mrjNP_001246364.1 DnaJ 2..>66 CDD:223560 39/63 (62%)
DnaJ 3..66 CDD:278647 39/62 (63%)
Dnajb8NP_001102718.1 DnaJ 3..66 CDD:278647 39/62 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 98 1.000 Domainoid score I6988
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52292
OrthoDB 1 1.010 - - D593036at33208
OrthoFinder 1 1.000 - - FOG0000721
OrthoInspector 1 1.000 - - otm46170
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43948
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X251
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.030

Return to query results.
Submit another query.