DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment mrj and dnajc3

DIOPT Version :9

Sequence 1:	NP_001246364.1	Gene:	mrj / 36797	FlyBaseID:	FBgn0034091	Length:	346	Species:	Drosophila melanogaster
Sequence 2:	XP_012812335.1	Gene:	dnajc3 / 496977	XenbaseID:	XB-GENE-997043	Length:	504	Species:	Xenopus tropicalis

Alignment Length:	106	Identity:	41/106 - (38%)
Similarity:	59/106 - (55%)	Gaps:	7/106 - (6%)

- Green bases have known domain annotations that are detailed below.

  Fly     3 DYYKILDVSRSATDSEVKKAYRKLALKWHPDKNPDNLD--EANKRFRELSEAYEVLSDARKRRIY 65
            ||||||.|.|:|...|:.|||||||.:||||...|..:  :|.|:|.:::.|.|||:|..||..:
Frog   394 DYYKILGVKRNAKKQEIIKAYRKLAQQWHPDNFQDEEEKKKAEKKFIDIASAKEVLTDPEKRSRF 458

  Fly    66 DA-RATLHKSSNSGSSSSNS----SSYTRYRNGGTGGSSSY 101
            || ...|...|..|:...:.    :.:..:...|:||..|:
Frog   459 DAGEDPLDPESQQGAGGPHFHRGWNQWQGFNPFGSGGPFSF 499

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
mrj	NP_001246364.1	DnaJ	2..>66	CDD:223560	32/64 (50%)
mrj	NP_001246364.1	DnaJ	3..66	CDD:278647	32/64 (50%)
dnajc3	XP_012812335.1	TPR repeat	37..65	CDD:276809
		PEP_TPR_lipo	47..>366	CDD:274350
		TPR repeat	70..100	CDD:276809
		TPR repeat	105..133	CDD:276809
		TPR repeat	154..182	CDD:276809
		TPR repeat	187..217	CDD:276809
		TPR repeat	222..250	CDD:276809
		TPR repeat	256..281	CDD:276809
		TPR repeat	300..335	CDD:276809
		TPR repeat	340..368	CDD:276809
		TPR repeat	374..397	CDD:276809	2/2 (100%)
		DnaJ	392..>494	CDD:223560	38/99 (38%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	1	1.000