DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mrj and dnaja1

DIOPT Version :9

Sequence 1:NP_001246364.1 Gene:mrj / 36797 FlyBaseID:FBgn0034091 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001011012.1 Gene:dnaja1 / 496421 XenbaseID:XB-GENE-976936 Length:400 Species:Xenopus tropicalis


Alignment Length:163 Identity:56/163 - (34%)
Similarity:83/163 - (50%) Gaps:30/163 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YYKILDVSRSATDSEVKKAYRKLALKWHPDKNPDNLDEANKRFRELSEAYEVLSDARKRRIYDAR 68
            ||.||.|..::|..|:||||||||||:||||||:.    .::|:::|:|||||||::||.:||  
 Frog     7 YYDILGVKPNSTPDELKKAYRKLALKYHPDKNPNE----GEKFKQISQAYEVLSDSKKRDLYD-- 65

  Fly    69 ATLHKSSNSGSSSSNSSSYTRYRNGGTGGSSSYGRDYD-YDYYPGSGYGSGSGRRSGN--RYQAF 130
                    .|...:       .:.||.|| ..:....| :|.:.|.|......||..|  ...:.
 Frog    66 --------KGGEQA-------IKEGGMGG-GGFASPMDIFDMFFGGGGRMQRERRGKNVVHQLSV 114

  Fly   131 TFRNIFEGTPFHKMFEKKRRIYDEY----GKDG 159
            :..:::.|.. .|:..:|..|.|:.    ||.|
 Frog   115 SLEDLYNGAT-RKLAVQKNTICDKCEGRGGKKG 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mrjNP_001246364.1 DnaJ 2..>66 CDD:223560 34/61 (56%)
DnaJ 3..66 CDD:278647 34/61 (56%)
dnaja1NP_001011012.1 PTZ00037 7..397 CDD:240236 56/163 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.