DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mrj and dnaja2

DIOPT Version :9

Sequence 1:NP_001246364.1 Gene:mrj / 36797 FlyBaseID:FBgn0034091 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001004807.1 Gene:dnaja2 / 448048 XenbaseID:XB-GENE-998337 Length:410 Species:Xenopus tropicalis


Alignment Length:413 Identity:89/413 - (21%)
Similarity:123/413 - (29%) Gaps:195/413 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YKILDVSRSATDSEVKKAYRKLALKWHPDKNPDNLDEANKRFRELSEAYEVLSDARKRRIYDARA 69
            |.||.|:..|:::::||||||||.::||||||:    |..:|:|:|.||||||:..||.:||...
 Frog    10 YDILGVAPGASENDLKKAYRKLAKEYHPDKNPN----AGDKFKEISFAYEVLSNPEKRELYDRYG 70

  Fly    70 TLHKSSNSGSSSSNS--------------SSYTRYRNG--------------------------- 93
            .......||.|..:.              ...:|.|||                           
 Frog    71 EQGLREGSGGSGMDDIFSHIFGGGLFGFMGGQSRSRNGRRRGEDMMHPLKVSLEDLYNGKTTKLQ 135

  Fly    94 -----------GTGG--------SSSYGRDYDY---DYYPG------------SGYGS------- 117
                       |.||        |:..||....   ...||            :|.|.       
 Frog   136 LSKNVLCSSCNGQGGKTGAVQKCSACRGRGVRVMIRQLAPGMVQQMQSVCSDCNGEGEVINEKDR 200

  Fly   118 --------------------GSGRRSGNRYQAFTFRNIFEGTPFHK-------MFEKKRRIYDEY 155
                                ..|.:.|.|   .||....:..|..:       :.||:..::...
 Frog   201 CKKCEGKKVVKEVKIIEVHVDKGMKHGQR---ITFSGEADQAPGVEPGDIVLVLQEKEHEVFQRD 262

  Fly   156 GKDGLGDRGQSRSHARHHYSTHDFDDFDILGGFQFAFR-----------PPEEVF-----REFFG 204
            |.|              .:.||.....:.|.||||.|:           ||.:|.     |...|
 Frog   263 GND--------------LHMTHRIGLVEALCGFQFTFKHLDARQIVVKYPPGKVIEPGSVRVVRG 313

  Fly   205 -----IHSPF--ADLF--------------------------------------RDANGHSNGST 224
                 ..:||  .|||                                      .:.:.....:|
 Frog   314 EGMPQYRNPFEKGDLFIKFDVIFPENNWINPDKLTELEDLLPSRPEAPAVSGETEEVDLQEFDNT 378

  Fly   225 SGSSGSRR----NGGSSGSSRHH 243
            .||||.:|    |..|...|.||
 Frog   379 RGSSGGQRREAYNDSSDDESSHH 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mrjNP_001246364.1 DnaJ 2..>66 CDD:223560 31/60 (52%)
DnaJ 3..66 CDD:278647 31/60 (52%)
dnaja2NP_001004807.1 PTZ00037 4..410 CDD:240236 89/413 (22%)
DnaJ 9..67 CDD:278647 31/60 (52%)
DnaJ_C 113..339 CDD:199909 38/242 (16%)
DnaJ_zf 142..208 CDD:199908 10/65 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.