DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mrj and dnajb1a

DIOPT Version :9

Sequence 1:NP_001246364.1 Gene:mrj / 36797 FlyBaseID:FBgn0034091 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001003571.1 Gene:dnajb1a / 445177 ZFINID:ZDB-GENE-040801-90 Length:335 Species:Danio rerio


Alignment Length:352 Identity:85/352 - (24%)
Similarity:120/352 - (34%) Gaps:155/352 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DYYKILDVSRSATDSEVKKAYRKLALKWHPDKNPDNLDEANKRFRELSEAYEVLSDARKRRIYDA 67
            |||:||.:.:.|:|.|:||||||.||::|||||..  ..|..:|:|::|||:|||||        
Zfish     4 DYYRILGIEKGASDEEIKKAYRKQALRFHPDKNKS--AGAEDKFKEIAEAYDVLSDA-------- 58

  Fly    68 RATLHKSSNSGSSSSNSSSYTRYRNGGTGGSSSYGRDYDYDYYPGSGYGSGSGRRSGNRYQAFTF 132
                                                                             
Zfish    59 ----------------------------------------------------------------- 58

  Fly   133 RNIFEGTPFHKMFEKKRRIYDEYGKDGL------GDRGQSRSHARHHYSTHDFDDFDILGGFQFA 191
                          ||:.|||.||:|||      |..|.|       |:.|.             
Zfish    59 --------------KKKDIYDRYGEDGLKGHAGSGTNGPS-------YTFHG------------- 89

  Fly   192 FRPPEEVFREFFGIHSPFADLFRDANGHSNG-STSGSSGSRRNGGSSGSSRHHHHHHQHKVASPF 255
              .|..:|.||||..|||...|..|.|.::| ......|:...||..|..|    ..:.:|..|.
Zfish    90 --DPHAMFAEFFGGRSPFDHFFASAGGPNDGMDIDDPFGAFGMGGMGGFPR----SFKSRVGGPH 148

  Fly   256 GA-------PM---LNYSMMDFFMPTSGFTSFSSMTHGNGSSGVTHISSGPGASVKRTSTSTVFV 310
            |:       |:   |..|:.:.|   :|.|....::...        .:..|.|::         
Zfish   149 GSREKKKDPPVVHELKVSLEEVF---AGCTKKMKISRKR--------LNPDGCSMR--------- 193

  Fly   311 NGKKLMT---KRVVENGKETVFSYEND 334
            |..|::|   ||..:.|.:..|..|.|
Zfish   194 NEDKILTVDIKRGWKEGTKITFPKEGD 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mrjNP_001246364.1 DnaJ 2..>66 CDD:223560 32/62 (52%)
DnaJ 3..66 CDD:278647 32/62 (52%)
dnajb1aNP_001003571.1 DnaJ 1..335 CDD:223560 85/352 (24%)
DnaJ 4..65 CDD:278647 35/149 (23%)
DnaJ_C 157..321 CDD:199909 17/84 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.