DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mrj and CG3061

DIOPT Version :9

Sequence 1:NP_001246364.1 Gene:mrj / 36797 FlyBaseID:FBgn0034091 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_650328.1 Gene:CG3061 / 41707 FlyBaseID:FBgn0038195 Length:370 Species:Drosophila melanogaster


Alignment Length:170 Identity:57/170 - (33%)
Similarity:86/170 - (50%) Gaps:34/170 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DYYKILDVSRSATDSEVKKAYRKLALKWHPDKNPDNLDEANKRFRELSEAYEVLSDARKRRIYDA 67
            |||::|.||::|||||:||||:||||:.|||||  ....|.:.|:.|..|..||:||.||:.|| 
  Fly   106 DYYEVLGVSKTATDSEIKKAYKKLALQLHPDKN--KAPGAVEAFKALGNAAGVLTDAEKRKNYD- 167

  Fly    68 RATLHKSSNSGSSSSNSSSYTRYRNGGTGGSSSYGRDYDYDYYPGSGYGSGSGRRSGNRYQA-FT 131
               |:..:.|.:...|        ||  ||...:|:.|:.:|    ||..|        :|| .:
  Fly   168 ---LYGINESHNGHGN--------NG--GGHHGHGQYYNNEY----GYSRG--------FQADIS 207

  Fly   132 FRNIFE-----GTPFHKMFEKKRRIYDEYGKDGLGDRGQS 166
            ...:|.     |.|...:..:::|...:..:|..|:...:
  Fly   208 AEELFNMFFNGGFPQQNVHMRQQRRRQQAREDREGNNSSA 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mrjNP_001246364.1 DnaJ 2..>66 CDD:223560 34/62 (55%)
DnaJ 3..66 CDD:278647 34/62 (55%)
CG3061NP_650328.1 DnaJ 105..>224 CDD:223560 54/145 (37%)
DnaJ 106..167 CDD:278647 34/62 (55%)
DUF1977 269..366 CDD:286411
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458981
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.