DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mrj and dnaja3b

DIOPT Version :9

Sequence 1:NP_001246364.1 Gene:mrj / 36797 FlyBaseID:FBgn0034091 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_958499.1 Gene:dnaja3b / 394242 ZFINID:ZDB-GENE-040115-3 Length:474 Species:Danio rerio


Alignment Length:114 Identity:43/114 - (37%)
Similarity:65/114 - (57%) Gaps:7/114 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DYYKILDVSRSATDSEVKKAYRKLALKWHPDKNPDNLDEANKRFRELSEAYEVLSDARKRRIYDA 67
            |:|::|.|.|:|:..|:||||.:||.|:|||.|||:.| |.::|.:|:||||.|||..||:.||.
Zfish    86 DFYEVLGVPRTASQKEIKKAYYQLAKKYHPDTNPDDPD-AKEKFAKLAEAYETLSDELKRKQYDT 149

  Fly    68 RATLHKSSNSGSSSSNSSSYTRYRNGGTGGSSSYGRDYDYDYYPGSGYG 116
                  ..::|.|:|.:.....:|...........|....::..|.|:|
Zfish   150 ------YGSAGPSASGTGQQQYWRGSANVDPEELFRKIFGEFAGGRGFG 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mrjNP_001246364.1 DnaJ 2..>66 CDD:223560 33/62 (53%)
DnaJ 3..66 CDD:278647 33/62 (53%)
dnaja3bNP_958499.1 DnaJ 85..428 CDD:223560 43/114 (38%)
DnaJ 86..148 CDD:278647 33/62 (53%)
DnaJ_C 203..409 CDD:199909
DnaJ_zf 229..289 CDD:199908
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.