powered by:
Protein Alignment mrj and dnajc5gb
DIOPT Version :9
Sequence 1: | NP_001246364.1 |
Gene: | mrj / 36797 |
FlyBaseID: | FBgn0034091 |
Length: | 346 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_005158621.1 |
Gene: | dnajc5gb / 393371 |
ZFINID: | ZDB-GENE-040426-1238 |
Length: | 212 |
Species: | Danio rerio |
Alignment Length: | 62 |
Identity: | 32/62 - (51%) |
Similarity: | 47/62 - (75%) |
Gaps: | 1/62 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 YKILDVSRSATDSEVKKAYRKLALKWHPDKNPDNLDEANKRFRELSEAYEVLSDARKRRIYD 66
|:.|.:.:.|:..::||||||||||.||||||:| .||.::|:|::.|..:|:|..||:|||
Zfish 19 YQTLGLQKGASSEDIKKAYRKLALKHHPDKNPNN-PEAAEKFKEINNANSILNDETKRQIYD 79
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.