DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mrj and DnaJ-1

DIOPT Version :9

Sequence 1:NP_001246364.1 Gene:mrj / 36797 FlyBaseID:FBgn0034091 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_523936.2 Gene:DnaJ-1 / 38643 FlyBaseID:FBgn0263106 Length:334 Species:Drosophila melanogaster


Alignment Length:226 Identity:63/226 - (27%)
Similarity:84/226 - (37%) Gaps:100/226 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DYYKILDVSRSATDSEVKKAYRKLALKWHPDKNPDNLDEANKRFRELSEAYEVLSDARKRRIYDA 67
            |:||||.:.|.|:|.|:||||||||||:|||||..  .:|.:||:|::||||||||.:||.|:| 
  Fly     4 DFYKILGLERKASDDEIKKAYRKLALKYHPDKNKS--PQAEERFKEIAEAYEVLSDKKKRDIFD- 65

  Fly    68 RATLHKSSNSGSSSSNSSSYTRYRNGGTGGSSSYGRDYDYDYYPGSGYGSGSGRRSGNRYQAFTF 132
                                            :||.|......||...|...|        |:|:
  Fly    66 --------------------------------NYGEDGLKGGQPGPDGGGQPG--------AYTY 90

  Fly   133 RNIFEGTPFHKMFEKKRRIYDEYGKDGLGDRGQSRSHARHHYSTHDFDDFDILGGFQFAFRPPEE 197
            :       ||                  ||                                |..
  Fly    91 Q-------FH------------------GD--------------------------------PRA 98

  Fly   198 VFREFFGIHSPFADLFRDANGHSNGSTSGSS 228
            .|.:|||...||...|...:...:|...|::
  Fly    99 TFAQFFGSSDPFGAFFTGGDNMFSGGQGGNT 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mrjNP_001246364.1 DnaJ 2..>66 CDD:223560 39/62 (63%)
DnaJ 3..66 CDD:278647 39/62 (63%)
DnaJ-1NP_523936.2 DnaJ 1..333 CDD:223560 63/226 (28%)
DnaJ 4..65 CDD:278647 39/62 (63%)
DnaJ_C 157..320 CDD:199909
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458988
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.