Sequence 1: | NP_001246364.1 | Gene: | mrj / 36797 | FlyBaseID: | FBgn0034091 | Length: | 346 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011543306.1 | Gene: | DNAJB13 / 374407 | HGNCID: | 30718 | Length: | 350 | Species: | Homo sapiens |
Alignment Length: | 205 | Identity: | 49/205 - (23%) |
---|---|---|---|
Similarity: | 69/205 - (33%) | Gaps: | 101/205 - (49%) |
- Green bases have known domain annotations that are detailed below.
Fly 14 ATDSEVKKAYRKLALKWHPDKNPDNLDEANKRFRELSEAYEVLSDARKRRIYDARATLHKSSNSG 78
Fly 79 SSSSNSSSYTRYRNGGTGGSSSYGRDYDYDYYPGSGYGSGSGRRSGNRYQAFTFRNIFEGTPFHK 143
Fly 144 MFEKKRRIYDEYGKDGLGDRGQSRSHARHHYSTHDFDDFDILGGFQFAFRPPEEVFREFFGIHSP 208
Fly 209 FADLFRDANG 218 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
mrj | NP_001246364.1 | DnaJ | 2..>66 | CDD:223560 | 23/51 (45%) |
DnaJ | 3..66 | CDD:278647 | 23/51 (45%) | ||
DNAJB13 | XP_011543306.1 | DnaJ_bact | 48..346 | CDD:274090 | 49/205 (24%) |
DnaJ | 48..99 | CDD:278647 | 23/51 (45%) | ||
DnaJ_C | 174..336 | CDD:199909 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0714 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |