powered by:
Protein Alignment mrj and Dnajc5g
DIOPT Version :9
Sequence 1: | NP_001246364.1 |
Gene: | mrj / 36797 |
FlyBaseID: | FBgn0034091 |
Length: | 346 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_017449734.1 |
Gene: | Dnajc5g / 366567 |
RGDID: | 1307426 |
Length: | 186 |
Species: | Rattus norvegicus |
Alignment Length: | 67 |
Identity: | 31/67 - (46%) |
Similarity: | 49/67 - (73%) |
Gaps: | 1/67 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 YKILDVSRSATDSEVKKAYRKLALKWHPDKNPDNLDEANKRFRELSEAYEVLSDARKRRIYDARA 69
|.:|::.:.|...|:|||||||||::||||||.| .:|.:.|::::.|:.||:|..|::|||...
Rat 19 YAVLELKKGAQPEEIKKAYRKLALQYHPDKNPGN-SQAAEFFKDINAAHAVLTDPTKKKIYDRHG 82
Fly 70 TL 71
:|
Rat 83 SL 84
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
mrj | NP_001246364.1 |
DnaJ |
2..>66 |
CDD:223560 |
28/60 (47%) |
DnaJ |
3..66 |
CDD:278647 |
28/60 (47%) |
Dnajc5g | XP_017449734.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.000 |
|
Return to query results.
Submit another query.