DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mrj and Dnajc5g

DIOPT Version :9

Sequence 1:NP_001246364.1 Gene:mrj / 36797 FlyBaseID:FBgn0034091 Length:346 Species:Drosophila melanogaster
Sequence 2:XP_017449734.1 Gene:Dnajc5g / 366567 RGDID:1307426 Length:186 Species:Rattus norvegicus


Alignment Length:67 Identity:31/67 - (46%)
Similarity:49/67 - (73%) Gaps:1/67 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YKILDVSRSATDSEVKKAYRKLALKWHPDKNPDNLDEANKRFRELSEAYEVLSDARKRRIYDARA 69
            |.:|::.:.|...|:|||||||||::||||||.| .:|.:.|::::.|:.||:|..|::|||...
  Rat    19 YAVLELKKGAQPEEIKKAYRKLALQYHPDKNPGN-SQAAEFFKDINAAHAVLTDPTKKKIYDRHG 82

  Fly    70 TL 71
            :|
  Rat    83 SL 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mrjNP_001246364.1 DnaJ 2..>66 CDD:223560 28/60 (47%)
DnaJ 3..66 CDD:278647 28/60 (47%)
Dnajc5gXP_017449734.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.