DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mrj and Dnajc24

DIOPT Version :9

Sequence 1:NP_001246364.1 Gene:mrj / 36797 FlyBaseID:FBgn0034091 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001178782.1 Gene:Dnajc24 / 362184 RGDID:1564710 Length:148 Species:Rattus norvegicus


Alignment Length:116 Identity:31/116 - (26%)
Similarity:54/116 - (46%) Gaps:26/116 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DYYKILDVSRSATDSEVKKAYRKLALKWHPDKN-----PDNLDEANKRFRELSEAYEVLSDARKR 62
            |:|.||....||..|::|:.|:||.|.:||||.     ...::|..::|.|:.:|:::|.:...:
  Rat    10 DWYSILGADPSADVSDLKQKYQKLILLYHPDKQSADVPAGTMEECVQKFIEIDQAWKILGNEETK 74

  Fly    63 RIYDAR-------------ATLHKSSNSGSSSSNSSS--------YTRYRN 92
            :.||.:             |.:|....|.:....|.|        ||.|::
  Rat    75 KKYDLQRHEDELRNVGPVDAQVHLEEMSWNKDEESFSLSCRCGGKYTVYKD 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mrjNP_001246364.1 DnaJ 2..>66 CDD:223560 21/67 (31%)
DnaJ 3..66 CDD:278647 21/67 (31%)
Dnajc24NP_001178782.1 DnaJ 10..78 CDD:395170 21/67 (31%)
zf-CSL 94..147 CDD:398744 8/32 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.