DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mrj and Dnajb1

DIOPT Version :9

Sequence 1:NP_001246364.1 Gene:mrj / 36797 FlyBaseID:FBgn0034091 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001382078.1 Gene:Dnajb1 / 361384 RGDID:1304725 Length:340 Species:Rattus norvegicus


Alignment Length:358 Identity:88/358 - (24%)
Similarity:125/358 - (34%) Gaps:140/358 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DYYKILDVSRSATDSEVKKAYRKLALKWHPDKNPDNLDEANKRFRELSEAYEVLSDARKRRIYDA 67
            |||:.|.::|.|:|.|:|:|||:.||::|||||.:  ..|.::|:|::|||:||||.|||.|:| 
  Rat     4 DYYQTLGLARGASDDEIKRAYRRQALRYHPDKNKE--PGAEEKFKEIAEAYDVLSDPRKREIFD- 65

  Fly    68 RATLHKSSNSGSSSSNSSSYTRYRNGGTGGSSSYGRDYDYDYYPGSGYGSGSGRRSGNRYQAFTF 132
                                 ||...|..|              |...|..||..:|..: ::||
  Rat    66 ---------------------RYGEEGLKG--------------GGPSGGSSGGANGTSF-SYTF 94

  Fly   133 RNIFEGTPFHKMFEKKRRIYDEYGKDGLGDRGQSRSHARHHYSTHDFDDFDILGGFQFAFRPPEE 197
            .                           ||                                |..
  Rat    95 H---------------------------GD--------------------------------PHA 100

  Fly   198 VFREFFGIHSPFADLFRDANGHSNGSTSG--SSGSRRNGG----SSGSSRHHHHHHQHKVASPFG 256
            :|.||||..:||...|...||........  ||.....||    :.|.||......:.|...|. 
  Rat   101 MFAEFFGGRNPFDTFFGQRNGEEGMDIDDPFSSFPMGMGGFTNMNFGRSRPTQEPTRKKQDPPV- 164

  Fly   257 APMLNYSMMDFFMPTSGFTSFSSMTHGNGSSGVTHISSGPGASVKRTSTSTVFVNGKKLMT---K 318
            ...|..|:.:.:   ||.|....::|..        .:..|.|::         |..|::|   |
  Rat   165 THDLRVSLEEIY---SGCTKKMKISHKR--------LNPDGKSIR---------NEDKILTIEVK 209

  Fly   319 RVVENGKETVFSYEND------------VLKSK 339
            |..:.|.:..|..|.|            |||.|
  Rat   210 RGWKEGTKITFPKEGDQTSNNIPADIVFVLKDK 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mrjNP_001246364.1 DnaJ 2..>66 CDD:223560 33/62 (53%)
DnaJ 3..66 CDD:278647 33/62 (53%)
Dnajb1NP_001382078.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.