DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mrj and dnj-13

DIOPT Version :9

Sequence 1:NP_001246364.1 Gene:mrj / 36797 FlyBaseID:FBgn0034091 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001366737.1 Gene:dnj-13 / 3564910 WormBaseID:WBGene00001031 Length:331 Species:Caenorhabditis elegans


Alignment Length:253 Identity:68/253 - (26%)
Similarity:90/253 - (35%) Gaps:116/253 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DYYKILDVSRSATDSEVKKAYRKLALKWHPDKNPDNLDEANKRFRELSEAYEVLSDARKRRIYDA 67
            ||||:|.:|:.|||.|:||||||:|||:|||||.:  ..|..:|:|::|||:||||.:|::||| 
 Worm     4 DYYKVLGISKGATDDEIKKAYRKMALKYHPDKNKE--AGAENKFKEIAEAYDVLSDDKKKKIYD- 65

  Fly    68 RATLHKSSNSGSSSSNSSSYTRYRNGGTGGSSSYGRDYDYDYYPGSGYGSGSGRRSGNRYQAFTF 132
                 :....|           .:.||                ||:|.|.|              
 Worm    66 -----QFGEEG-----------LKEGG----------------PGAGGGGG-------------- 84

  Fly   133 RNIFEGTPFHKMFEKKRRIYDEYGKDGLGDRGQSRSHARHHYSTHDFDDFDILGGFQFAFR-PPE 196
                                                                 ||..:.|| .|.
 Worm    85 -----------------------------------------------------GGMHYEFRGDPM 96

  Fly   197 EVFREFFGIHSPFA-------DLFRDANG------HSNGSTSGSSGSRRNGGSSGSSR 241
            .:|..|||...||.       ||...|.|      :..|...|..|....||..|.:|
 Worm    97 NIFSSFFGGSDPFGAGGPGMFDLGGGAGGPNMFFMNQGGMDDGMFGGMHQGGRRGHAR 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mrjNP_001246364.1 DnaJ 2..>66 CDD:223560 36/62 (58%)
DnaJ 3..66 CDD:278647 36/62 (58%)
dnj-13NP_001366737.1 DnaJ 1..331 CDD:223560 68/253 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.