DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mrj and DnaJ-H

DIOPT Version :9

Sequence 1:NP_001246364.1 Gene:mrj / 36797 FlyBaseID:FBgn0034091 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster


Alignment Length:181 Identity:61/181 - (33%)
Similarity:84/181 - (46%) Gaps:50/181 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VDYYKILDVSRSATDSEVKKAYRKLALKWHPDKNPDNLDEANKRFRELSEAYEVLSDARKRRIYD 66
            ::.|.:|.|:..|||.|:||.|||||.::|||||||    |..:|:|:|.|||||||..||||||
  Fly     4 LNLYDVLKVAPDATDEEIKKNYRKLAKEFHPDKNPD----AGDKFKEISFAYEVLSDPEKRRIYD 64

  Fly    67 ARATLHKSSNSGSSSSNSSSYTRY-----RNGGTGGSSSYGRDYDYDYYPGSGYGS-GSGRRSGN 125
                                  ||     :.|..|.|.:  .::...::|.....| |.|||:|.
  Fly    65 ----------------------RYGLKGLQEGAEGFSDA--SEFFAQWFPFDRVSSEGRGRRNGK 105

  Fly   126 RY--QAFTFRNIFEGTPFHKMFEKKRRIYDEYGKDGL-----GDRGQSRSH 169
            ..  ...|...|:.|       ..|:::  ||.:..|     ||.|...:|
  Fly   106 VVVKVELTLEEIYVG-------GMKKKV--EYNRQKLCSKCNGDGGPKEAH 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mrjNP_001246364.1 DnaJ 2..>66 CDD:223560 36/63 (57%)
DnaJ 3..66 CDD:278647 36/62 (58%)
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 61/181 (34%)
DnaJ 5..64 CDD:278647 36/62 (58%)
DnaJ_C 106..329 CDD:199909 11/51 (22%)
DnaJ_zf 134..197 CDD:199908 4/14 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.