DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment mrj and wus

DIOPT Version :9

Sequence 1:	NP_001246364.1	Gene:	mrj / 36797	FlyBaseID:	FBgn0034091	Length:	346	Species:	Drosophila melanogaster
Sequence 2:	NP_001285355.1	Gene:	wus / 32683	FlyBaseID:	FBgn0030805	Length:	406	Species:	Drosophila melanogaster

Alignment Length:	61	Identity:	27/61 - (44%)
Similarity:	41/61 - (67%)	Gaps:	2/61 - (3%)

- Green bases have known domain annotations that are detailed below.

  Fly     5 YKILDVSRSATDSEVKKAYRKLALKWHPDKNPDN--LDEANKRFRELSEAYEVLSDARKRR 63
            ||:|.||.:|:.:|:..|||||:.::||||..|.  ..:|::||.|:.:||.|||..:..|
  Fly   331 YKVLGVSATASQAEITAAYRKLSKEYHPDKVKDEGLRAQAHQRFIEIQQAYSVLSKIKSNR 391

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
mrj	NP_001246364.1	DnaJ	2..>66	CDD:223560	27/61 (44%)
mrj	NP_001246364.1	DnaJ	3..66	CDD:278647	27/61 (44%)
wus	NP_001285355.1	TM2	47..97	CDD:282945
		DnaJ	327..>385	CDD:223560	24/53 (45%)
		DnaJ	331..385	CDD:278647	24/53 (45%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0714
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	0.900