DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mrj and dnajc11a

DIOPT Version :9

Sequence 1:NP_001246364.1 Gene:mrj / 36797 FlyBaseID:FBgn0034091 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_997796.1 Gene:dnajc11a / 322953 ZFINID:ZDB-GENE-030131-1673 Length:563 Species:Danio rerio


Alignment Length:144 Identity:45/144 - (31%)
Similarity:63/144 - (43%) Gaps:26/144 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DYYKILDVSRSATDSEVKKAYRKLALKWHPDK--NPDNLDEANKRFRELSEAYEVLSDARKRRIY 65
            |||.:|:|.|.||..|:|.:||:|.:.:||||  :|:...:|.:.|..:.:|||||||.:.|.||
Zfish    14 DYYSLLNVRREATQEELKASYRRLCMLYHPDKHRDPELKKQAEQLFNLVHQAYEVLSDPQARAIY 78

  Fly    66 DARA----------TLHKSSNSGSSSSNSSSYTRYR-------NGGTGGSSSYGRD-------YD 106
            |...          .:.:...............|.|       .....|:.|.|.|       |:
Zfish    79 DIYGKKGLDVEGWEVVERKRTPAEIREEYERLQREREERRLQQRTNPKGTISVGIDATDLFDYYE 143

  Fly   107 YDYYPGSGYGSGSG 120
            .||...||.|.|.|
Zfish   144 EDYDEISGGGGGGG 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mrjNP_001246364.1 DnaJ 2..>66 CDD:223560 29/64 (45%)
DnaJ 3..66 CDD:278647 29/64 (45%)
dnajc11aNP_997796.1 DnaJ 14..79 CDD:278647 29/64 (45%)
DUF3395 421..553 CDD:288708
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.