DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mrj and Dnajb5

DIOPT Version :9

Sequence 1:NP_001246364.1 Gene:mrj / 36797 FlyBaseID:FBgn0034091 Length:346 Species:Drosophila melanogaster
Sequence 2:XP_038966057.1 Gene:Dnajb5 / 313811 RGDID:1307453 Length:420 Species:Rattus norvegicus


Alignment Length:354 Identity:89/354 - (25%)
Similarity:130/354 - (36%) Gaps:125/354 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DYYKILDVSRSATDSEVKKAYRKLALKWHPDKNPDNLDEANKRFRELSEAYEVLSDARKRRIYDA 67
            ||||||.:...|.:.|:||||||:|||:|||||.:  ..|.::|:|::|||:||||.:||.:||.
  Rat    76 DYYKILGIPSGANEDEIKKAYRKMALKYHPDKNKE--PNAEEKFKEIAEAYDVLSDPKKRSLYDQ 138

  Fly    68 RATLHKSSNSGSSSSNSSSYTRYRNGGTGGSSSYGRDYDYDYYPGSGYGSGSGRRSGNRYQAFTF 132
            .......:..|:|            ||:|||      :.|.::             |:.:.  ||
  Rat   139 YGEEGLKTGGGTS------------GGSGGS------FHYTFH-------------GDPHA--TF 170

  Fly   133 RNIFEGT-PFHKMFEKKRRIYDEYGKDGLGDRGQSRSHARHHYSTHDFDDFDILGGFQFAFRPPE 196
            .:.|.|: ||...|                    :.|.:...:|..|.||.|:        ...|
  Rat   171 ASFFGGSNPFDIFF--------------------ASSRSTRPFSGFDPDDMDV--------DEDE 207

  Fly   197 EVFREF--FGIHSPFADLFRDANGHSNGSTSGSSGSRRNGGSSGSSRHHHH-HHQHKVASPFGAP 258
            :.|..|  ||.                           ||.|.|..|.... :.:.||..|....
  Rat   208 DPFGAFGRFGF---------------------------NGLSRGPRRAPEPLYPRRKVQDPPVVH 245

  Fly   259 MLNYSMMDFFMPTSGFTSFSSMTHGNGS-SGVTHISSGPGASVKRTSTSTVFVNGKKLMTKRVVE 322
            .|..|:.:.:             ||:.. ..:|.....|.....||....:.:     :.||..:
  Rat   246 ELRVSLEEIY-------------HGSTKRMKITRRRLNPDGRTVRTEDKILHI-----VIKRGWK 292

  Fly   323 NGKETVFSYEND------------VLKSK 339
            .|.:..|..|.|            |||.|
  Rat   293 EGTKITFPKEGDATPDNIPADIVFVLKDK 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mrjNP_001246364.1 DnaJ 2..>66 CDD:223560 34/62 (55%)
DnaJ 3..66 CDD:278647 34/62 (55%)
Dnajb5XP_038966057.1 DnaJ 72..415 CDD:223560 89/354 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.