DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mrj and Dnajb4

DIOPT Version :9

Sequence 1:NP_001246364.1 Gene:mrj / 36797 FlyBaseID:FBgn0034091 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001013094.1 Gene:Dnajb4 / 295549 RGDID:1305826 Length:337 Species:Rattus norvegicus


Alignment Length:151 Identity:53/151 - (35%)
Similarity:77/151 - (50%) Gaps:34/151 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DYYKILDVSRSATDSEVKKAYRKLALKWHPDKNPDNLDEANKRFRELSEAYEVLSDARKRRIYDA 67
            |||.||.:.:.|||.::||||||.|||:|||||..  .:|.::|:|::||||||||.:||.||| 
  Rat     4 DYYHILGIEKGATDEDIKKAYRKQALKFHPDKNKS--PQAEEKFKEVAEAYEVLSDPKKREIYD- 65

  Fly    68 RATLHKSSNSGSSSSNSSSYTRYRNGGTGGSSSYGRDYDYDYY--PGSGYGSGSGRRSGNRYQAF 130
                 :....|            ..||.||:...|..:.|.::  |.:.:.:..|  ..|.::.|
  Rat    66 -----QFGEEG------------LKGGAGGTDGQGGTFRYTFHGDPHATFAAFFG--GANPFEIF 111

  Fly   131 TFRNI----------FEGTPF 141
            ..|.:          .:|.||
  Rat   112 FGRRMGGGRDSEEMEIDGDPF 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mrjNP_001246364.1 DnaJ 2..>66 CDD:223560 36/62 (58%)
DnaJ 3..66 CDD:278647 36/62 (58%)
Dnajb4NP_001013094.1 DnaJ 1..332 CDD:223560 53/151 (35%)
DnaJ 4..65 CDD:278647 36/62 (58%)
DnaJ_C 158..320 CDD:199909
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.