DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mrj and Dnajc18

DIOPT Version :9

Sequence 1:NP_001246364.1 Gene:mrj / 36797 FlyBaseID:FBgn0034091 Length:346 Species:Drosophila melanogaster
Sequence 2:XP_006254608.1 Gene:Dnajc18 / 291677 RGDID:1310237 Length:357 Species:Rattus norvegicus


Alignment Length:302 Identity:70/302 - (23%)
Similarity:95/302 - (31%) Gaps:148/302 - (49%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DYYKILDVSRSATDSEVKKAYRKLALKWHPDKN--PDNLDEANKRFRELSEAYEVLSDARKRRIY 65
            :||.||.||.:|:|.|:||||:|||||:|||||  |.    |...|:.:..|:.|||:       
  Rat    82 NYYDILGVSHNASDEELKKAYKKLALKFHPDKNCAPG----ATDAFKAIGNAFAVLSN------- 135

  Fly    66 DARATLHKSSNSGSSSSNSSSYTRYRNGGTGGSSSYGRDYDYDYYPGSGYGSGSGRRSGNRYQAF 130
                                                                             
  Rat   136 ----------------------------------------------------------------- 135

  Fly   131 TFRNIFEGTPFHKMFEKKRRIYDEYGKDGLGDRGQSRSHARHHYSTHDFDDFDILGGFQFAFRPP 195
                           ..||..|||||.:.: .....|:...|:|...:.|            ..|
  Rat   136 ---------------PDKRLRYDEYGDEQV-TLTAPRARPYHYYRDVEAD------------ISP 172

  Fly   196 EEVFREFFGIHSPFADLFRDANGHSNGSTSGSSGSRRNGGSSGSSRHHHHHHQ------HKVASP 254
            ||:|..|||.|.|..::...:|     .|..|...||        ||.|...|      .|..:|
  Rat   173 EELFNVFFGGHFPSGNIHMFSN-----VTDDSHYYRR--------RHRHERTQAHKREEDKSQTP 224

  Fly   255 FGA-----PML----------------NYSMMDFFMPTSGFT 275
            :.|     |:|                .||:  |:..|.|:|
  Rat   225 YSAFVQLLPVLLIVTISVITQLLAANPPYSL--FYKSTLGYT 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mrjNP_001246364.1 DnaJ 2..>66 CDD:223560 30/64 (47%)
DnaJ 3..66 CDD:278647 30/64 (47%)
Dnajc18XP_006254608.1 DnaJ 82..143 CDD:278647 32/151 (21%)
DUF1977 250..349 CDD:286411 6/17 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.