DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mrj and SPBC3E7.11c

DIOPT Version :9

Sequence 1:NP_001246364.1 Gene:mrj / 36797 FlyBaseID:FBgn0034091 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_596098.1 Gene:SPBC3E7.11c / 2540676 PomBaseID:SPBC3E7.11c Length:355 Species:Schizosaccharomyces pombe


Alignment Length:103 Identity:39/103 - (37%)
Similarity:63/103 - (61%) Gaps:7/103 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DYYKILDVSRSATDSEVKKAYRKLALKWHPDKNPDNLDEANKRFRELSEAYEVLSDARKRRIYDA 67
            |||.||::|..|....:||:||:||:.:|||||.:|.:.|.::|::|:|||:||||.:.|..||.
pombe     9 DYYDILNISVDADGDTIKKSYRRLAILYHPDKNRENPEAAREKFQKLAEAYQVLSDPKLREKYDK 73

  Fly    68 RATLHKSSNSGSSSSNSSSYTRYRNGGTGGSSSYGRDY 105
            ...:....::|.    ..::..::|  ..|..|: |||
pombe    74 LGKVGAVPDAGF----EDAFEFFKN--LFGGDSF-RDY 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mrjNP_001246364.1 DnaJ 2..>66 CDD:223560 30/62 (48%)
DnaJ 3..66 CDD:278647 30/62 (48%)
SPBC3E7.11cNP_596098.1 DnaJ 8..>102 CDD:223560 36/99 (36%)
DnaJ 9..72 CDD:278647 30/62 (48%)
DnaJ-X 150..350 CDD:291006
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X251
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.