DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mrj and Dnajb9

DIOPT Version :9

Sequence 1:NP_001246364.1 Gene:mrj / 36797 FlyBaseID:FBgn0034091 Length:346 Species:Drosophila melanogaster
Sequence 2:XP_038967719.1 Gene:Dnajb9 / 24908 RGDID:3070 Length:234 Species:Rattus norvegicus


Alignment Length:260 Identity:70/260 - (26%)
Similarity:101/260 - (38%) Gaps:104/260 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DYYKILDVSRSATDSEVKKAYRKLALKWHPDKN--PDNLDEANKRFRELSEAYEVLSDARKRRIY 65
            :||.||.|.:||::.::|||:.|||:|:|||||  ||    |..:|||::||||.||||.:|:  
  Rat    38 NYYDILGVPKSASERQIKKAFHKLAMKYHPDKNKSPD----AEAKFREIAEAYETLSDANRRK-- 96

  Fly    66 DARATLHKSSNSGSSSSNSSSYTRYRNGGTGGSSSYGRDYDYDYYPGSGYGSGSGRRSGNRYQAF 130
                                                    :||....|.:.:|.|:||       
  Rat    97 ----------------------------------------EYDIIGHSAFTNGKGQRS------- 114

  Fly   131 TFRNIFEGTPFHKMFEKKRRIYDEYGKD----GLGDRGQSRSHARHHYST---------HDFDDF 182
                  .|:||.:.|...   :|:..||    |.....:|:.|..:|:.|         |.|.:|
  Rat   115 ------NGSPFEQSFNFN---FDDLFKDFNLFGQNQNTRSKKHFENHFQTRQDGSSRQRHHFQEF 170

  Fly   183 DILGGFQFAFRPPEEVFREFFGIHSPFADLFRDANGHSNGSTSGSSGSRRNGGSS-----GSSRH 242
            ...||.                    |.|:|.|.  ....|.||...:.|....:     |||:|
  Rat   171 SFGGGL--------------------FDDMFEDM--EKMFSFSGFDSTNRRTVQTENRFHGSSKH 213

  Fly   243  242
              Rat   214  213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mrjNP_001246364.1 DnaJ 2..>66 CDD:223560 34/64 (53%)
DnaJ 3..66 CDD:278647 34/64 (53%)
Dnajb9XP_038967719.1 DnaJ 35..>147 CDD:223560 50/170 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.