DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mrj and DNAJC21

DIOPT Version :9

Sequence 1:NP_001246364.1 Gene:mrj / 36797 FlyBaseID:FBgn0034091 Length:346 Species:Drosophila melanogaster
Sequence 2:XP_011512267.2 Gene:DNAJC21 / 134218 HGNCID:27030 Length:676 Species:Homo sapiens


Alignment Length:211 Identity:64/211 - (30%)
Similarity:88/211 - (41%) Gaps:61/211 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YYKILDVSRSATDSEVKKAYRKLALKWHPDKNPDNLDEANKRFRELSEAYEVLSDARKRRIYD-A 67
            :|:.|.|.|.|::.|:||||||||||||||||.||..||.::|:.:..||:||||.::|..|| .
Human    91 HYEALGVRRDASEEELKKAYRKLALKWHPDKNLDNAAEAAEQFKLIQAAYDVLSDPQERAWYDNH 155

  Fly    68 RATLHKSSNSGSSSSNSSSYTRYRNGGTGGSSSYGRDYDYDYYPGSGYGSGSGRRSGNRYQAF-- 130
            |..|.|....|....:|....||              :....|  ||||...        :.|  
Human   156 REALLKGGFDGEYQDDSLDLLRY--------------FTVTCY--SGYGDDE--------KGFYT 196

  Fly   131 TFRNIFEGTPFHKMFEKK--RRIYDEYGKDGLGDRGQSRSHARHHYSTHDFDDFDILGGFQFAFR 193
            .:||:||      |..|:  ..:.:|                       :.|||...|..|..: 
Human   197 VYRNVFE------MIAKEELESVLEE-----------------------EVDDFPTFGDSQSDY- 231

  Fly   194 PPEEVFREFFGIHSPF 209
              :.|...|:.....|
Human   232 --DTVVHPFYAYWQSF 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mrjNP_001246364.1 DnaJ 2..>66 CDD:223560 34/61 (56%)
DnaJ 3..66 CDD:278647 34/61 (56%)
DNAJC21XP_011512267.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.