DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mrj and DNAJA2

DIOPT Version :9

Sequence 1:NP_001246364.1 Gene:mrj / 36797 FlyBaseID:FBgn0034091 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_005871.1 Gene:DNAJA2 / 10294 HGNCID:14884 Length:412 Species:Homo sapiens


Alignment Length:120 Identity:45/120 - (37%)
Similarity:62/120 - (51%) Gaps:16/120 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YKILDVSRSATDSEVKKAYRKLALKWHPDKNPDNLDEANKRFRELSEAYEVLSDARKRRIYDARA 69
            |.||.|...|:::|:||||||||.::||||||:    |..:|:|:|.||||||:..||.:||...
Human    10 YDILGVPPGASENELKKAYRKLAKEYHPDKNPN----AGDKFKEISFAYEVLSNPEKRELYDRYG 70

  Fly    70 TLHKSSNSGSSSSNSSSYTRYRNGGTGGSSSYGRDYDYDYYPGSGYGSGSGRRSG 124
            .......||........::....||..|            :.|:...|.:|||.|
Human    71 EQGLREGSGGGGGMDDIFSHIFGGGLFG------------FMGNQSRSRNGRRRG 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mrjNP_001246364.1 DnaJ 2..>66 CDD:223560 32/60 (53%)
DnaJ 3..66 CDD:278647 32/60 (53%)
DNAJA2NP_005871.1 PTZ00037 4..412 CDD:240236 45/120 (38%)
CXXCXGXG motif 143..150
CXXCXGXG motif 159..166
CXXCXGXG motif 186..193
CXXCXGXG motif 202..209
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 365..412
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.