DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mrj and DNAJB6

DIOPT Version :9

Sequence 1:NP_001246364.1 Gene:mrj / 36797 FlyBaseID:FBgn0034091 Length:346 Species:Drosophila melanogaster
Sequence 2:XP_005249572.1 Gene:DNAJB6 / 10049 HGNCID:14888 Length:334 Species:Homo sapiens


Alignment Length:349 Identity:121/349 - (34%)
Similarity:150/349 - (42%) Gaps:124/349 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVDYYKILDVSRSATDSEVKKAYRKLALKWHPDKNPDNLDEANKRFRELSEAYEVLSDARKRRIY 65
            |||||::|.|.|.|:..::|||||||||||||||||:|.:||.::|::::|||||||||      
Human     1 MVDYYEVLGVQRHASPEDIKKAYRKLALKWHPDKNPENKEEAERKFKQVAEAYEVLSDA------ 59

  Fly    66 DARATLHKSSNSGSSSSNSSSYTRYRNGGTGGSSSYGRDYDYDYYPGSGYGSGSGRRSGNRYQAF 130
                                                                             
Human    60 ----------------------------------------------------------------- 59

  Fly   131 TFRNIFEGTPFHKMFEKKRRIYDEYGKDGLGDRGQSRSHARHHYSTHDFDDFDILGGFQFAFRPP 195
                            |||.|||:|||:||...|...||            ||....|.|.||.|
Human    60 ----------------KKRDIYDKYGKEGLNGGGGGGSH------------FDSPFEFGFTFRNP 96

  Fly   196 EEVFREFFGIHSPFA-DLFRDANGHSNGSTSGSSGSRRNGGSSGSSRHHHHHHQHKVASPFGAPM 259
            ::|||||||...||: |.|.|......|:..|..|||..|..|..|...            |.|.
Human    97 DDVFREFFGGRDPFSFDFFEDPFEDFFGNRRGPRGSRSRGTGSFFSAFS------------GFPS 149

  Fly   260 LNYSMMDFFMPTSGFTSFSSMTHGNGSSGVTHISS----GPG-ASVKRTSTSTVFVNGKKLMTKR 319
            .......|   .:|||||.|:.||    |:|..||    |.| .:.|..||||..|||:|:.|||
Human   150 FGSGFSSF---DTGFTSFGSLGHG----GLTSFSSTSFGGSGMGNFKSISTSTKMVNGRKITTKR 207

  Fly   320 VVENGKETVFSYENDVLKSKTVMG 343
            :||||:|.|...|:..|||.|:.|
Human   208 IVENGQERVEVEEDGQLKSLTING 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mrjNP_001246364.1 DnaJ 2..>66 CDD:223560 38/63 (60%)
DnaJ 3..66 CDD:278647 37/62 (60%)
DNAJB6XP_005249572.1 DnaJ 2..>106 CDD:223560 65/202 (32%)
DnaJ 3..66 CDD:278647 41/149 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I6829
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 140 1.000 Inparanoid score I4500
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52292
OrthoDB 1 1.010 - - D593036at33208
OrthoFinder 1 1.000 - - FOG0000721
OrthoInspector 1 1.000 - - otm42025
orthoMCL 1 0.900 - - OOG6_102921
Panther 1 1.100 - - O PTHR43948
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X251
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.840

Return to query results.
Submit another query.