DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG44243 and AIM22

DIOPT Version :9

Sequence 1:NP_001188958.1 Gene:CG44243 / 36795 FlyBaseID:FBgn0265178 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_012489.2 Gene:AIM22 / 853401 SGDID:S000003582 Length:409 Species:Saccharomyces cerevisiae


Alignment Length:366 Identity:101/366 - (27%)
Similarity:173/366 - (47%) Gaps:79/366 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 TRLASSGVEPPSAGQQEI--------KKQRRQPPPVVPDSEIK-----KSVFISQ--SSDVFTNL 72
            |..|||..|..||..:::        .||      ::..|:::     |..|:.|  |:..:.||
Yeast    72 TTKASSMEEDISAFNKDLYNFYNIGYAKQ------IMSASQLENIVKAKGRFVIQSLSTSPYYNL 130

  Fly    73 ALEDWLYKNFDFSRHHV----LLLWANDPCVVIGRHQNPFTEANVSQLVERGITLARRNSGGGAV 133
            |||::::||...::...    ||.:.||.|.|||::||.:.|.::::|..:...|.||.||||.|
Yeast   131 ALENYVFKNTPRAKRGPDNCRLLFYINDRCAVIGKNQNLWQEVDLAKLKSKNFELLRRFSGGGTV 195

  Fly   134 YHDLGNLNCTFFSPRERYDRK-YNLNIVTRALFREW------AIKAEINERDDIVVMNKKISGTA 191
            .|||||:|.::.:.||:::.| :|..|:      :|      .::.::|||.||:....||||:|
Yeast   196 LHDLGNVNYSYLTSREKFETKFFNKMII------KWLNSLNPELRLDLNERGDIIQDGFKISGSA 254

  Fly   192 AKLGHPNSYHHCTILASANKLHLGESLVREPA-----NYISKATASVPSPIRN--LVDVNRTVNV 249
            .|:....:|||.|:|.:|:.......|  ||:     .:.|....||.|.|:|  ::..|:.:.|
Yeast   255 YKIAGGKAYHHATMLLNADLEQFSGLL--EPSLPNNMEWESSGVHSVKSKIKNVGIITPNQFIAV 317

  Fly   250 AQLRSAVGYEYLRTAATTLEDGGSTQTMQQRGFQLVNPTEKWFPGIEELRSNYSSWDWVIGKTPK 314
            ...|          ...|.:..|.........|:.:|..      |::..:...|..|.....||
Yeast   318 VSER----------FQKTFKVDGEIPIYYCDEFKSINDE------IKDAMNTLQSEQWKYFSGPK 366

  Fly   315 FTVQKELEVKGDEQDMKLKLSVEVEAGLMKE------IGIQ 349
            |:|  :::.||        |:::||.|::.:      ||::
Yeast   367 FSV--KIKDKG--------LTIKVEKGMIYDCDRNDLIGLE 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG44243NP_001188958.1 LplA 63..311 CDD:223173 77/267 (29%)
lipoyltrans 60..380 CDD:161920 90/316 (28%)
AIM22NP_012489.2 BPL_LplA_LipB 117..409 CDD:417464 90/315 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343852
Domainoid 1 1.000 107 1.000 Domainoid score I1434
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I1401
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54427
OrthoFinder 1 1.000 - - FOG0003725
OrthoInspector 1 1.000 - - oto99132
orthoMCL 1 0.900 - - OOG6_101366
Panther 1 1.100 - - LDO PTHR12561
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R663
SonicParanoid 1 1.000 - - X3085
TreeFam 00.000 Not matched by this tool.
1211.930

Return to query results.
Submit another query.