DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG44243 and LIPT1

DIOPT Version :9

Sequence 1:NP_001188958.1 Gene:CG44243 / 36795 FlyBaseID:FBgn0265178 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001191759.1 Gene:LIPT1 / 51601 HGNCID:29569 Length:373 Species:Homo sapiens


Alignment Length:321 Identity:124/321 - (38%)
Similarity:192/321 - (59%) Gaps:30/321 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 VPDSEIKKSV-----FISQSSDVFTNLALEDWLYKNFDFSRHHVLLLWANDPCVVIGRHQNPFTE 110
            ||.:..||:|     ..|.|:||:.|||:|||::.:.:.....:|..|.|.|.|||||||||:.|
Human    19 VPAAGFKKTVKNGLILQSISNDVYQNLAVEDWIHDHMNLEGKPILFFWQNSPSVVIGRHQNPWQE 83

  Fly   111 ANVSQLVERGITLARRNSGGGAVYHDLGNLNCTFFSPRERYDRKYNLNIVTRALFREWAIKAEIN 175
            .|::.:.|.||.||||.||||.||||:||:|.|||:.:::|||..||.::.|||.   |::.:::
Human    84 CNLNLMREEGIKLARRRSGGGTVYHDMGNINLTFFTTKKKYDRMENLKLIVRALN---AVQPQLD 145

  Fly   176 ----ERDDIVVMNK-KISGTAAKLGHPNSYHHCTILASANKLHLGESLVREPANYI-SKATASVP 234
                :|.|:::..: ||||||:|:|...:|||||:|.|.:...| .||::.|...| |.||||:|
Human   146 VQATKRFDLLLDGQFKISGTASKIGRTTAYHHCTLLCSTDGTFL-SSLLKSPYQGIRSNATASIP 209

  Fly   235 SPIRNLVDVNRTVNVAQLRSAVGYEYLRTAATTLEDGGSTQTMQQRGFQLVNPT-EKWFPGIEEL 298
            |.::||::.:.|:....|.:||..||   ||....|         ....|:||| |..||||...
Human   210 SLVKNLLEKDPTLTCEVLMNAVATEY---AAYHQID---------NHIHLINPTDETLFPGINSK 262

  Fly   299 RSNYSSWDWVIGKTPKFTVQKELEVKGDEQDMKLKLSVEVEAGLMKEIGIQLPQSDQLVPV 359
            .....:|:|:.||||||::.....|..::..:::|:.::::.|.::...|:.|  |..:|:
Human   263 AKELQTWEWIYGKTPKFSINTSFHVLYEQSHLEIKVFIDIKNGRIEICNIEAP--DHWLPL 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG44243NP_001188958.1 LplA 63..311 CDD:223173 106/254 (42%)
lipoyltrans 60..380 CDD:161920 120/312 (38%)
LIPT1NP_001191759.1 LplA 33..235 CDD:319742 90/205 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147270
Domainoid 1 1.000 215 1.000 Domainoid score I2707
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H50569
Inparanoid 1 1.050 215 1.000 Inparanoid score I3617
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54427
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003725
OrthoInspector 1 1.000 - - oto88755
orthoMCL 1 0.900 - - OOG6_101366
Panther 1 1.100 - - LDO PTHR12561
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R663
SonicParanoid 1 1.000 - - X3085
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1312.930

Return to query results.
Submit another query.