DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment calypso and UCH2

DIOPT Version :9

Sequence 1:NP_611096.1 Gene:calypso / 36794 FlyBaseID:FBgn0262166 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_564858.1 Gene:UCH2 / 842876 AraportID:AT1G65650 Length:330 Species:Arabidopsis thaliana


Alignment Length:389 Identity:119/389 - (30%)
Similarity:189/389 - (48%) Gaps:72/389 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 WLELESDPGLFTLLLKDFGCHDVQVEEVYDLQ-------KPIESPYGFIFLFRWIEERRARRKIV 103
            |..:|||||:||.|::......|||||:|.|.       :|:   ||.||||:|....:..|..:
plant     3 WCTIESDPGVFTELIQQMQVKGVQVEELYSLDSDSLNNLRPV---YGLIFLFKWQAGEKDERPTI 64

  Fly   104 ETTAEIFVKDEEAISSIFFAQQVVPNSCATHALLSVLLNCNENNLQLGDTLSRLKTHTKGMSPEN 168
                      ::.:|::|||.||:.|:|||.|:|::|||..|  :.:|..||.||..||....:.
plant    65 ----------QDQVSNLFFANQVINNACATQAILAILLNSPE--VDIGPELSALKEFTKNFPSDL 117

  Fly   169 KGLAIGNTPELACAHNSHAMPQARRRLERTGAGVSSCRFTGEAFHFVSFVPINGQLFELDGLKPY 233
            |||||.|:..:..||||.|.|:.....|:..|....     :.:||:|::|::|.|:||||||..
plant   118 KGLAINNSDSIRAAHNSFARPEPFVPEEQKAATKDD-----DVYHFISYIPVDGVLYELDGLKEG 177

  Fly   234 PMNHG---GWEDSEDWTDKFRRVMAERLGIATGEQDIRFNLMAVVPDRRIAITHKLKMLRTNQAI 295
            |::.|   |.:...:|....:.|:.||:. ...:.:|||||:||:.:|:...|.:||.|:..:  
plant   178 PISLGPCPGDQTGIEWLQMVQPVIQERIE-RYSQSEIRFNLLAVIKNRKDIYTAELKELQRQR-- 239

  Fly   296 VSGTLQKLLKADEQGESGNGDSQRPDTPTTLLEPSAFTARDLQSLLKNLDTEIAINEQHLADEND 360
                 ::||             |:.:|.....|..|..|     |:..:.:.|......:..|.:
plant   240 -----EQLL-------------QQANTCVDKSEAEAVNA-----LIAEVGSGIEAASDKIVMEEE 281

  Fly   361 RRHMFKVDASRRTHNYDKFICTFLSMLAHQGVLGELVSQHLLPSKKVSGQGAANRISKQSTTAS 424
            :...::.:..||.|||..|:..||.:||.:..|..|:                .:..||.|.:|
plant   282 KFMKWRTENIRRKHNYIPFLFNFLKLLAEKKQLKPLI----------------EKAKKQKTESS 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
calypsoNP_611096.1 Peptidase_C12_UCH37_BAP1 46..274 CDD:187738 86/237 (36%)
UCH2NP_564858.1 Peptidase_C12_UCH37_BAP1 3..220 CDD:187738 86/237 (36%)
UCH_C 269..314 CDD:407868 12/44 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2778
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1363547at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10589
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.