DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment calypso and Uchl5

DIOPT Version :9

Sequence 1:NP_611096.1 Gene:calypso / 36794 FlyBaseID:FBgn0262166 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_001380778.1 Gene:Uchl5 / 360853 RGDID:1305414 Length:329 Species:Rattus norvegicus


Alignment Length:372 Identity:123/372 - (33%)
Similarity:187/372 - (50%) Gaps:68/372 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 MAQLADGWLELESDPGLFTLLLKDFGCHDVQVEEVYDLQ-------KPIESPYGFIFLFRWIEER 96
            |:..|..|..:|||||:||.|:|.|||...||||::.|:       ||:   :|.||||:|....
  Rat     1 MSSNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPV---HGLIFLFKWQPGE 62

  Fly    97 RARRKIVETTAEIFVKDEEAISSIFFAQQVVPNSCATHALLSVLLNCNENNLQLGDTLSRLKTHT 161
            .....:|:         :..:.:||||:||:.|:|||.|::||||||...::.||:|||..|..:
  Rat    63 EPAGSVVQ---------DSRLETIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFS 118

  Fly   162 KGMSPENKGLAIGNTPELACAHNSHAMPQARRRLERTGAGVSSCRFTGEAFHFVSFVPINGQLFE 226
            :......||||:.|:..:...|||.|..|......:|.|...      :||||||:||:||:|:|
  Rat   119 QSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDTKTSAKEE------DAFHFVSYVPVNGRLYE 177

  Fly   227 LDGLKPYPMNHGGWEDSEDWTDKFRRVMAERLGIATGEQDIRFNLMAVVPDRRIAITHKLKMLRT 291
            ||||:..|::.|.. :.:||....|.|:.:|:. ...|.:|||||||:|.||::....|:     
  Rat   178 LDGLREGPIDLGAC-NQDDWITAVRPVIEKRIQ-KYSEGEIRFNLMAIVSDRKMIYEQKI----- 235

  Fly   292 NQAIVSGTLQKLLKADEQGESGNGDSQRPDTPTTLLEPSAFTARDLQSLLKNLDTEIAINEQHLA 356
                  ..||:.|..:|..::..|                      .::|..:.:|:|.|:..:.
  Rat   236 ------AELQRQLAEEEPMDTDQG----------------------STVLSAIQSEVARNQMLIE 272

  Fly   357 DENDRRHMFKVDASRRTHNYDKFICTFLSMLAHQGVLGELVSQHLLP 403
            :|..:...:|::..||.|||..||...|..||..        |.|:|
  Rat   273 EEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEH--------QQLIP 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
calypsoNP_611096.1 Peptidase_C12_UCH37_BAP1 46..274 CDD:187738 92/234 (39%)
Uchl5NP_001380778.1 Peptidase_C12 8..223 CDD:187736 92/234 (39%)
UCH_C 264..309 CDD:407868 15/52 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1363547at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.