DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment calypso and uch2

DIOPT Version :9

Sequence 1:NP_611096.1 Gene:calypso / 36794 FlyBaseID:FBgn0262166 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_595456.1 Gene:uch2 / 2540956 PomBaseID:SPBC409.06 Length:300 Species:Schizosaccharomyces pombe


Alignment Length:336 Identity:104/336 - (30%)
Similarity:157/336 - (46%) Gaps:81/336 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 WLELESDPGLFTLLLKDFGCHDVQVEEVYDLQ----KPIESPYGFIFLFRWIEERRARRKIVETT 106
            |..:|||.|:||.|:::.|..||:|:|:|.|.    :.....||.||||:|      ..|:.:..
pombe     3 WTTIESDAGVFTDLIENLGVKDVEVDELYSLDVDSLRQFPDIYGIIFLFKW------NSKVDKPD 61

  Fly   107 AEIFVKDEEAISSIFFAQQVVPNSCATHALLSVLLNCNENNLQLGDTLSRLKTHTKGMSPENKGL 171
            ..:   |.:::.:||||:||:.|:|||.|||||||| :.:.:.||.|||..|..:|.:.||.||.
pombe    62 GTM---DYDSMDNIFFAKQVINNACATQALLSVLLN-HSDEIDLGTTLSEFKDFSKTLPPELKGE 122

  Fly   172 AIGNTPELACAHNSHAMPQARRRLERTGAGVSSCRFTGEAFHFVSFVPINGQLFELDGLKPYPMN 236
            |:||:..:.|.|||.|     |........|.:.....|.:||:::..||...:|||||:..|:|
pombe   123 ALGNSEHIRCCHNSFA-----RSDPFISEEVRAATDEDEVYHFIAYTNINNVFYELDGLQAAPIN 182

  Fly   237 HGGWEDSEDWTDKFRRVMAERLGIATGE-QDIRFNLMAVVPDRRIAITHKLKMLRTNQAIVSGTL 300
            ||.. ..|::.:|...|:..|  ||..: .:||||||.:..|::                     
pombe   183 HGSC-TKEEFAEKAVSVIQAR--IANYDPAEIRFNLMVICKDKK--------------------- 223

  Fly   301 QKLLKADEQGESGNGDSQRPDTPTTLLEPSAFTARDLQSLLKNLDTEIAINEQHLADENDRRHMF 365
                                        .|..|..||      .|.|.|.:   :|.|:::|..:
pombe   224 ----------------------------ASLLTREDL------TDEEKAAS---IAVEDEKRLRW 251

  Fly   366 KVDASRRTHNY 376
            |.:...|.||:
pombe   252 KRENQLRRHNF 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
calypsoNP_611096.1 Peptidase_C12_UCH37_BAP1 46..274 CDD:187738 89/232 (38%)
uch2NP_595456.1 Peptidase_C12_UCH37_BAP1 3..218 CDD:187738 89/232 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2778
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10589
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.