DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment calypso and ubh-2

DIOPT Version :9

Sequence 1:NP_611096.1 Gene:calypso / 36794 FlyBaseID:FBgn0262166 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_001294721.2 Gene:ubh-2 / 24105081 WormBaseID:WBGene00006722 Length:227 Species:Caenorhabditis elegans


Alignment Length:249 Identity:68/249 - (27%)
Similarity:101/249 - (40%) Gaps:36/249 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 MAQLADGWLELESDPGLFTLLLKDFGCHDVQVEEVY----DLQKPIESP-YGFIFLFRWIEERRA 98
            ||....||..|||:|......|...|...|:..:|:    ::.:.|.:| ...|..|.....|..
 Worm     1 MASATGGWQALESNPETINPFLSKIGVSGVECVDVFSFDDEMLQFIPTPQLALILCFPSSGVREF 65

  Fly    99 RRKIVETTAEIFVKDEEAISSIFFAQQ--VVPNSCATHALLSVLLNCNENNLQLGD-----TLSR 156
            |.|..|...    |:.:....|||..|  .:.::|.|.:|...|.|. ||.:.||:     ...:
 Worm    66 RAKQYEEVE----KNGKKPDGIFFMNQKKEIGHACGTFSLFHSLANL-ENRVNLGNGKFSKWFEK 125

  Fly   157 LKTHTKGMSPENKGLAIGNTPELACAHNSHAMPQARRRLERTGAGVSSCRFTGEAFHFVSFVPIN 221
            .|...:|   |...|.:.:| :||.||...|........|..            |:||:::|..|
 Worm   126 AKLVGEG---ERSDLLLADT-DLAEAHKETAEEGETEHPEHV------------AYHFITYVNKN 174

  Fly   222 GQLFELDGLKPYPMNHGGWEDSEDWTDKFRRVMAERLGIATGEQDIRFNLMAVV 275
            |||||:|...|:|...|...||....|.|...:.:   :....|.:.|:.||:|
 Worm   175 GQLFEIDSCSPFPRPLGATTDSTMIRDAFSTSIKD---LMDNVQKLSFSAMALV 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
calypsoNP_611096.1 Peptidase_C12_UCH37_BAP1 46..274 CDD:187738 63/239 (26%)
ubh-2NP_001294721.2 Peptidase_C12_UCH_L1_L3 8..224 CDD:187737 63/239 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156487
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.